Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

LAT англ Linker for activation of T cells білок який кодується однойменним геном розташованим у людей на короткому плечі

LAT

LAT

LAT (англ. Linker for activation of T-cells) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми. Довжина поліпептидного ланцюга білка становить 262 амінокислот, а молекулярна маса — 27 930.

LAT
Ідентифікатори
Символи LAT, Lat, LAT1, pp36, linker for activation of T-cells, IMD52, linker for activation of T cells
Зовнішні ІД OMIM: 602354 MGI: 1342293 HomoloGene: 7811 GeneCards: LAT
Ортологи
Види Людина Миша
Entrez
27040
16797
Ensembl
ENSG00000213658
ENSMUSG00000030742
UniProt
O43561
O54957
RefSeq (мРНК)
NM_001014987
NM_001014988
NM_001014989
NM_014387
NM_010689
RefSeq (білок)
NP_001014987
NP_001014988
NP_001014989
NP_055202
NP_034819
Локус (UCSC) Хр. 16: 28.98 – 28.99 Mb Хр. 7: 125.96 – 125.97 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQ
FKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRD
SDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDAD
EDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDY
VNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEE
GAPDYENLQELN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як адаптивний імунітет, імунітет, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.

Література

  • Zhang W., Sloan-Lancaster J., Kitchen J., Trible R.P., Samelson L.E. (1998). LAT: the ZAP-70 tyrosine kinase substrate that links T cell receptor to cellular activation. Cell. 92: 83—92. PMID 9489702 DOI:10.1016/S0092-8674(00)80901-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Zhang W., Trible R.P., Samelson L.E. (1998). LAT palmitoylation: its essential role in membrane microdomain targeting and tyrosine phosphorylation during T cell activation. Immunity. 9: 239—246. PMID 9729044 DOI:10.1016/S1074-7613(00)80606-8
  • Lindholm C.K., Gylfe E., Zhang W., Samelson L.E., Welsh M. (1999). Requirement of the Src homology 2 domain protein Shb for T cell receptor-dependent activation of the interleukin-2 gene nuclear factor for activation of T cells element in Jurkat T cells. J. Biol. Chem. 274: 28050—28057. PMID 10488157 DOI:10.1074/jbc.274.39.28050
  • Baker J.E., Majeti R., Tangye S.G., Weiss A. (2001). Protein tyrosine phosphatase CD148-mediated inhibition of T-cell receptor signal transduction is associated with reduced LAT and phospholipase Cgamma1 phosphorylation. Mol. Cell. Biol. 21: 2393—2403. PMID 11259588 DOI:10.1128/MCB.21.7.2393-2403.2001
  • Lin J., Weiss A. (2003). The tyrosine phosphatase CD148 is excluded from the immunologic synapse and down-regulates prolonged T cell signaling. J. Cell Biol. 162: 673—682. PMID 12913111 DOI:10.1083/jcb.200303040

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:18874 (англ.) . Процитовано 11 вересня 2017.
  4. (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 11 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.
На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до .

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

LAT angl Linker for activation of T cells bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 16 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 262 aminokislot a molekulyarna masa 27 930 LATIdentifikatoriSimvoliLAT Lat LAT1 pp36 linker for activation of T cells IMD52 linker for activation of T cellsZovnishni ID OMIM 602354 MGI 1342293 HomoloGene 7811 GeneCards LATOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding protein kinase bindingKlitinna komponenta integral component of membrane membrana cell cell junction mast cell granule immunological synapse membrane raft COP9 signalosome kompleks Goldzhi klitinna membranaBiologichnij proces GO 0007243 intracellular signal transduction adaptivna imunna vidpovid ekspresiya geniv homeostasis of number of cells regulation of T cell activation proces imunnoyi sistemi lymphocyte homeostasis MAPK cascade Fc epsilon receptor signaling pathway GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid integrin mediated signaling pathway mast cell degranulation inflammatory response T cell receptor signaling pathway T cell activation calcium mediated signaling GO 0072468 signalna transdukciya positive regulation of protein kinase activity Ras protein signal transduction positive regulation of signal transductionDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez27040 16797Ensembl ENSG00000213658 ENSMUSG00000030742UniProt O43561 O54957RefSeq mRNK NM 001014987 NM 001014988 NM 001014989 NM 014387NM 010689RefSeq bilok NP 001014987 NP 001014988 NP 001014989 NP 055202NP 034819Lokus UCSC Hr 16 28 98 28 99 MbHr 7 125 96 125 97 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQ FKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRD SDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDAD EDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDY VNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEE GAPDYENLQELN A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak adaptivnij imunitet imunitet alternativnij splajsing Lokalizovanij u klitinnij membrani membrani LiteraturaZhang W Sloan Lancaster J Kitchen J Trible R P Samelson L E 1998 LAT the ZAP 70 tyrosine kinase substrate that links T cell receptor to cellular activation Cell 92 83 92 PMID 9489702 DOI 10 1016 S0092 8674 00 80901 0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang W Trible R P Samelson L E 1998 LAT palmitoylation its essential role in membrane microdomain targeting and tyrosine phosphorylation during T cell activation Immunity 9 239 246 PMID 9729044 DOI 10 1016 S1074 7613 00 80606 8 Lindholm C K Gylfe E Zhang W Samelson L E Welsh M 1999 Requirement of the Src homology 2 domain protein Shb for T cell receptor dependent activation of the interleukin 2 gene nuclear factor for activation of T cells element in Jurkat T cells J Biol Chem 274 28050 28057 PMID 10488157 DOI 10 1074 jbc 274 39 28050 Baker J E Majeti R Tangye S G Weiss A 2001 Protein tyrosine phosphatase CD148 mediated inhibition of T cell receptor signal transduction is associated with reduced LAT and phospholipase Cgamma1 phosphorylation Mol Cell Biol 21 2393 2403 PMID 11259588 DOI 10 1128 MCB 21 7 2393 2403 2001 Lin J Weiss A 2003 The tyrosine phosphatase CD148 is excluded from the immunologic synapse and down regulates prolonged T cell signaling J Cell Biol 162 673 682 PMID 12913111 DOI 10 1083 jcb 200303040PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 18874 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 1 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 16 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij

Дата публікації:
Топ