Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

IRF3 англ Interferon regulatory factor 3 білок який кодується однойменним геном розташованим у людей на короткому плечі

IRF3

IRF3

IRF3 (англ. Interferon regulatory factor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 427 амінокислот, а молекулярна маса — 47 219.

IRF3
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IRF3, entrez:3661, IIAE7, interferon regulatory factor 3
Зовнішні ІД OMIM: 603734 MGI: 1859179 HomoloGene: 1208 GeneCards: IRF3
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
3661
54131
Ensembl
ENSG00000126456
ENSMUSG00000003184
UniProt
Q14653
P70671
RefSeq (мРНК)
NM_016849
RefSeq (білок)
NP_058545
Локус (UCSC) Хр. 19: 49.66 – 49.67 Mb Хр. 7: 44.65 – 44.65 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQED
FGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDP
HDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLA
PLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGE
EWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGM
SLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGE
SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHP
LSLTSDQYKAYLQDLVEGMDFQGPGES

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, противірусний захист, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література

  • Au W.W.-C., Moore P.P.A., Lowther W.W., Juang Y.-T., Pitha P.M. (1995). Identification of a member of the interferon regulatory factor family that binds to the interferon-stimulated response element and activates expression of interferon-induced genes. Proc. Natl. Acad. Sci. U.S.A. 92: 11657—11661. PMID 8524823 DOI:10.1073/pnas.92.25.11657
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Bellingham J., Gregory-Evans K., Gregory-Evans C.Y. (1998). Mapping of human interferon regulatory factor 3 (IRF3) to chromosome 19q13.3-13.4 by an intragenic polymorphic marker. Ann. Hum. Genet. 62: 231—234. PMID 9803267 DOI:10.1046/j.1469-1809.1998.6230231.x
  • Lin R., Heylbroeck C., Pitha P.M., Hiscott J. (1998). Virus-dependent phosphorylation of the IRF-3 transcription factor regulates nuclear translocation, transactivation potential, and proteasome-mediated degradation. Mol. Cell. Biol. 18: 2986—2996. PMID 9566918 DOI:10.1128/MCB.18.5.2986
  • Kumar K.P., McBride K.M., Weaver B.K., Dingwall C., Reich N.C. (2000). Regulated nuclear-cytoplasmic localization of interferon regulatory factor 3, a subunit of double-stranded RNA-activated factor 1. Mol. Cell. Biol. 20: 4159—4168. PMID 10805757 DOI:10.1128/MCB.20.11.4159-4168.2000
  • Smith E.J., Marie I.J., Prakash A., Garcia-Sastre A., Levy D.E. (2001). IRF3 and IRF7 phosphorylation in virus-infected cells does not require double-stranded RNA-dependent protein kinase R or Ikappa B kinase but is blocked by Vaccinia virus E3L protein. J. Biol. Chem. 276: 8951—8957. PMID 11124948 DOI:10.1074/jbc.M008717200

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:6118 (англ.) . Процитовано 12 вересня 2017.
  4. (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 12 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

IRF3 angl Interferon regulatory factor 3 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 427 aminokislot a molekulyarna masa 47 219 IRF3Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3QU6 1J2F 1QWT 1T2K 1ZOQ 2O61 2O6G 2PI0 3A77 5JEO 5JEK 5JER 5JEM 5JEL 5JEJIdentifikatoriSimvoliIRF3 entrez 3661 IIAE7 interferon regulatory factor 3Zovnishni ID OMIM 603734 MGI 1859179 HomoloGene 1208 GeneCards IRF3Ontologiya genaMolekulyarna funkciya DNA binding protein homodimerization activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001104 transcription coregulator activity GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific GO 0001948 GO 0016582 protein binding protein domain specific binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific sequence specific DNA binding identical protein binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specificKlitinna komponenta citoplazma nukleoplazma klitinne yadro gialoplazmaBiologichnij proces GO 0097285 apoptoz positive regulation of type I interferon mediated signaling pathway macrophage apoptotic process GO 0009373 regulation of transcription DNA templated response to bacterium response to exogenous dsRNA positive regulation of interferon alpha production MDA 5 signaling pathway interferon gamma mediated signaling pathway proces imunnoyi sistemi GO 1901227 negative regulation of transcription by RNA polymerase II transcription by RNA polymerase II cellular response to dsRNA transcription DNA templated cellular response to DNA damage stimulus TRIF dependent toll like receptor signaling pathway response to lipopolysaccharide defense response to virus type I interferon signaling pathway positive regulation of I kappaB kinase NF kappaB signaling negative regulation of type I interferon production programmed necrotic cell death GO 0022415 viral process cellular response to lipopolysaccharide positive regulation of type I interferon production lipopolysaccharide mediated signaling pathway positive regulation of interferon beta production vrodzhenij imunitet regulation of type I interferon production GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of defense response to virus by host regulyaciya ekspresiyi geniv regulation of inflammatory response cellular response to exogenous dsRNA GO 0060469 GO 0009371 positive regulation of transcription DNA templatedDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3661 54131Ensembl ENSG00000126456 ENSMUSG00000003184UniProt Q14653 P70671RefSeq mRNK NM 001197122 NM 001197123 NM 001197124 NM 001197125 NM 001197126NM 001197127 NM 001197128 NM 001571NM 016849RefSeq bilok NP 001184051 NP 001184052 NP 001184053 NP 001184054 NP 001184055NP 001184056 NP 001184057 NP 001562 NP 001184053 1 NP 001184056 1 NP 001184057 1NP 058545Lokus UCSC Hr 19 49 66 49 67 MbHr 7 44 65 44 65 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQED FGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDP HDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLA PLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGE EWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGM SLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGE SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHP LSLTSDQYKAYLQDLVEGMDFQGPGES A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet vzayemodiya hazyayin virus transkripciya regulyaciya transkripciyi protivirusnij zahist alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u citoplazmi yadri LiteraturaAu W W C Moore P P A Lowther W W Juang Y T Pitha P M 1995 Identification of a member of the interferon regulatory factor family that binds to the interferon stimulated response element and activates expression of interferon induced genes Proc Natl Acad Sci U S A 92 11657 11661 PMID 8524823 DOI 10 1073 pnas 92 25 11657 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Bellingham J Gregory Evans K Gregory Evans C Y 1998 Mapping of human interferon regulatory factor 3 IRF3 to chromosome 19q13 3 13 4 by an intragenic polymorphic marker Ann Hum Genet 62 231 234 PMID 9803267 DOI 10 1046 j 1469 1809 1998 6230231 x Lin R Heylbroeck C Pitha P M Hiscott J 1998 Virus dependent phosphorylation of the IRF 3 transcription factor regulates nuclear translocation transactivation potential and proteasome mediated degradation Mol Cell Biol 18 2986 2996 PMID 9566918 DOI 10 1128 MCB 18 5 2986 Kumar K P McBride K M Weaver B K Dingwall C Reich N C 2000 Regulated nuclear cytoplasmic localization of interferon regulatory factor 3 a subunit of double stranded RNA activated factor 1 Mol Cell Biol 20 4159 4168 PMID 10805757 DOI 10 1128 MCB 20 11 4159 4168 2000 Smith E J Marie I J Prakash A Garcia Sastre A Levy D E 2001 IRF3 and IRF7 phosphorylation in virus infected cells does not require double stranded RNA dependent protein kinase R or Ikappa B kinase but is blocked by Vaccinia virus E3L protein J Biol Chem 276 8951 8957 PMID 11124948 DOI 10 1074 jbc M008717200PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6118 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 31 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ