HPRT1 (англ. Hypoxanthine phosphoribosyltransferase 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі X-хромосоми. Довжина поліпептидного ланцюга білка становить 218 амінокислот, а молекулярна маса — 24 579.
HPRT1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | HPRT1, HGPRT, HPRT, hypoxanthine phosphoribosyltransferase 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 308000 MGI: 96217 HomoloGene: 56590 GeneCards: HPRT1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
Lesch-Nyhan syndrome | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. X: 134.46 – 134.52 Mb | Хр. X: 52.08 – 52.11 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MATRSPGVVI | SDDEPGYDLD | LFCIPNHYAE | DLERVFIPHG | LIMDRTERLA | ||||
RDVMKEMGGH | HIVALCVLKG | GYKFFADLLD | YIKALNRNSD | RSIPMTVDFI | ||||
RLKSYCNDQS | TGDIKVIGGD | DLSTLTGKNV | LIVEDIIDTG | KTMQTLLSLV | ||||
RQYNPKMVKV | ASLLVKRTPR | SVGYKPDFVG | FEIPDKFVVG | YALDYNEYFR | ||||
DLNHVCVISE | TGKAKYKA |
Кодований геном білок за функціями належить до трансфераз, глікозилтрансфераз, фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Білок має сайт для зв'язування з нуклеотидами, іонами металів, іоном магнію. Локалізований у цитоплазмі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Patel P.I., Framson P.E., Caskey C.T., Chinault A.C. (1986). Fine structure of the human hypoxanthine phosphoribosyltransferase gene. Mol. Cell. Biol. 6: 393—403. PMID 3023844 DOI:10.1128/MCB.6.2.393
- Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli. Proc. Natl. Acad. Sci. U.S.A. 111: 12432—12437. PMID 25114211 DOI:10.1073/pnas.1413825111
- Eads J.C., Scapin G., Xu Y., Grubmeyer C., Sacchettini J.C. (1994). The crystal structure of human hypoxanthine-guanine phosphoribosyltransferase with bound GMP. Cell. 78: 325—334. PMID 8044844 DOI:10.1016/0092-8674(94)90301-8
- Sculley D.G., Dawson P.A., Emmerson B.T., Gordon R.B. (1992). A review of the molecular basis of hypoxanthine-guanine phosphoribosyltransferase (HPRT) deficiency. Hum. Genet. 90: 195—207. PMID 1487231 DOI:10.1007/BF00220062
- Keough D.T., Brereton I.M., de Jersey J., Guddat L.W. (2005). The crystal structure of free human hypoxanthine-guanine phosphoribosyltransferase reveals extensive conformational plasticity throughout the catalytic cycle. J. Mol. Biol. 351: 170—181. PMID 15990111 DOI:10.1016/j.jmb.2005.05.061
Примітки
- Захворювання, генетично пов'язані з HPRT1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 3 жовтня 2014. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 9 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
HPRT1 angl Hypoxanthine phosphoribosyltransferase 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi X hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 218 aminokislot a molekulyarna masa 24 579 HPRT1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1BZY 1D6N 1HMP 1Z7G 3GEP 3GGC 3GGJ 2VFA 4IJQ 4KN6 4RAB 4RAC 4RAD 4RAN 4RAO 4RAQ 5BSK 5BRNIdentifikatoriSimvoliHPRT1 HGPRT HPRT hypoxanthine phosphoribosyltransferase 1Zovnishni ID OMIM 308000 MGI 96217 HomoloGene 56590 GeneCards HPRT1Pov yazani genetichni zahvoryuvannyaLesch Nyhan syndrome Ontologiya genaMolekulyarna funkciya transferase activity nucleotide binding protein homodimerization activity glycosyltransferase activity hypoxanthine phosphoribosyltransferase activity guanine phosphoribosyltransferase activity zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding magnesium ion binding identical protein bindingKlitinna komponenta citoplazma ekzosoma gialoplazmaBiologichnij proces purine nucleotide biosynthetic process marafet Citoliz purine ribonucleoside salvage GMP catabolic process locomotory behavior dendrite morphogenesis hypoxanthine metabolic process guanine salvage response to amphetamine purine containing compound salvage nucleoside metabolic process dopamine metabolic process central nervous system neuron development lymphocyte proliferation cerebral cortex neuron differentiation IMP metabolic process protein homotetramerization striatum development hypoxanthine salvage adenine metabolic process positive regulation of dopamine metabolic process adenine salvage IMP salvage T cell mediated cytotoxicity GMP salvageDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3251 15452Ensembl ENSG00000165704 ENSMUSG00000025630UniProt P00492 P00493RefSeq mRNK NM 000194NM 013556RefSeq bilok NP 000185NP 038584Lokus UCSC Hr X 134 46 134 52 MbHr X 52 08 52 11 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLA RDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFI RLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLV RQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFR DLNHVCVISETGKAKYKA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz glikoziltransferaz fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak acetilyuvannya Bilok maye sajt dlya zv yazuvannya z nukleotidami ionami metaliv ionom magniyu Lokalizovanij u citoplazmi LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Patel P I Framson P E Caskey C T Chinault A C 1986 Fine structure of the human hypoxanthine phosphoribosyltransferase gene Mol Cell Biol 6 393 403 PMID 3023844 DOI 10 1128 MCB 6 2 393 Impens F Radoshevich L Cossart P Ribet D 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli Proc Natl Acad Sci U S A 111 12432 12437 PMID 25114211 DOI 10 1073 pnas 1413825111 Eads J C Scapin G Xu Y Grubmeyer C Sacchettini J C 1994 The crystal structure of human hypoxanthine guanine phosphoribosyltransferase with bound GMP Cell 78 325 334 PMID 8044844 DOI 10 1016 0092 8674 94 90301 8 Sculley D G Dawson P A Emmerson B T Gordon R B 1992 A review of the molecular basis of hypoxanthine guanine phosphoribosyltransferase HPRT deficiency Hum Genet 90 195 207 PMID 1487231 DOI 10 1007 BF00220062 Keough D T Brereton I M de Jersey J Guddat L W 2005 The crystal structure of free human hypoxanthine guanine phosphoribosyltransferase reveals extensive conformational plasticity throughout the catalytic cycle J Mol Biol 351 170 181 PMID 15990111 DOI 10 1016 j jmb 2005 05 061PrimitkiZahvoryuvannya genetichno pov yazani z HPRT1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 3 zhovtnya 2014 Procitovano 12 veresnya 2017 angl Arhiv originalu za 9 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma X Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi