Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

HIF1A англ Hypoxia inducible factor 1 alpha subunit білок який кодується однойменним геном розташованим у людей на корот

HIF1A

HIF1A

HIF1A (англ. Hypoxia inducible factor 1 alpha subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми. Довжина поліпептидного ланцюга білка становить 826 амінокислот, а молекулярна маса — 92 670.

HIF1A
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HIF1A, HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78, hypoxia inducible factor 1 alpha subunit, hypoxia inducible factor 1 subunit alpha, HIF-1α
Зовнішні ІД OMIM: 603348 MGI: 106918 HomoloGene: 1171 GeneCards: HIF1A
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
3091
15251
Ensembl
ENSG00000100644
ENSMUSG00000021109
UniProt
Q16665
Q61221
RefSeq (мРНК)
NM_181054
NM_001243084
NM_001530
NM_010431
NM_001313919
NM_001313920
RefSeq (білок)
NP_001230013
NP_001521
NP_851397
NP_001521.1
NP_001300848
NP_001300849
NP_034561
Локус (UCSC) Хр. 14: 61.7 – 61.75 Mb Хр. 12: 73.95 – 73.99 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNV
SSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFV
MVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTH
RNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHV
YDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDM
KFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDL
IFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLL
APAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAM
SPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPS
PSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPF
STQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKE
TTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT
VPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSL
SWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDC
EVNAPIQGSRNLLQGEELLRALDQVN

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Є основним фактором, індукованим гіпоксією.

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література

  • Wang G.L., Jiang B.-H., Rue E.A., Semenza G.L. (1995). Hypoxia-inducible factor 1 is a basic-helix-loop-helix-PAS heterodimer regulated by cellular O2 tension. Proc. Natl. Acad. Sci. U.S.A. 92: 5510—5514. PMID 7539918 DOI:10.1073/pnas.92.12.5510
  • Iyer N.V., Leung S.W., Semenza G.L. (1998). The human hypoxia-inducible factor 1alpha gene: HIF1A structure and evolutionary conservation. Genomics. 52: 159—165. PMID 9782081 DOI:10.1006/geno.1998.5416
  • Lukashev D., Sitkovsky M. (2008). Preferential expression of the novel alternative isoform I.3 of hypoxia-inducible factor 1alpha in activated human T lymphocytes. Hum. Immunol. 69: 421—425. PMID 18638657 DOI:10.1016/j.humimm.2008.05.004
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Jiang B.H., Zheng J.Z., Leung S.W., Roe R., Semenza G.L. (1997). Transactivation and inhibitory domains of hypoxia-inducible factor 1alpha. Modulation of transcriptional activity by oxygen tension. J. Biol. Chem. 272: 19253—19260. PMID 9235919 DOI:10.1074/jbc.272.31.19253
  • Huang L.E., Gu J., Schau M., Bunn H.F. (1998). Regulation of hypoxia-inducible factor 1alpha is mediated by an O2-dependent degradation domain via the ubiquitin-proteasome pathway. Proc. Natl. Acad. Sci. U.S.A. 95: 7987—7992. PMID 9653127 DOI:10.1073/pnas.95.14.7987

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:4910 (англ.) . Процитовано 11 вересня 2017.
  4. (англ.) . Архів оригіналу за 13 вересня 2017. Процитовано 11 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

HIF1A angl Hypoxia inducible factor 1 alpha subunit bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 826 aminokislot a molekulyarna masa 92 670 HIF1ANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1H2K 1H2L 1H2M 1L3E 1L8C 1LM8 1LQB 2ILM 3HQR 3HQU 4AJY 4H6JIdentifikatoriSimvoliHIF1A HIF 1 alpha HIF 1A HIF 1alpha HIF1 HIF1 ALPHA MOP1 PASD8 bHLHe78 hypoxia inducible factor 1 alpha subunit hypoxia inducible factor 1 subunit alpha HIF 1aZovnishni ID OMIM 603348 MGI 106918 HomoloGene 1171 GeneCards HIF1AOntologiya genaMolekulyarna funkciya protein dimerization activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific histone deacetylase binding transcription factor binding enzyme binding GO 0001948 GO 0016582 protein binding histone acetyltransferase binding protein kinase binding Hsp90 protein binding sequence specific DNA binding DNA binding transcription factor activity RNA polymerase II distal enhancer sequence specific binding ubiquitin protein ligase binding protein heterodimerization activity E box binding p53 binding protein domain specific binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific RNA polymerase II transcription regulatory region sequence specific DNA bindingKlitinna komponenta citoplazma gialoplazma klitinne yadro nuclear speck motile cilium transcription regulator complex RNA polymerase II transcription regulator complex axon cytoplasm nukleoplazma yaderni tilcya GO 0009327 protein containing complexBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process B 1 B cell homeostasis regulation of transforming growth factor beta2 production muscle cell cellular homeostasis outflow tract morphogenesis negative regulation of ossification heart looping negative regulation of TOR signaling blood vessel development hemoglobin biosynthetic process Angiogenez positive regulation of chemokine mediated signaling pathway positive regulation of insulin secretion involved in cellular response to glucose stimulus positive regulation of hormone biosynthetic process negative regulation of mesenchymal cell apoptotic process regulation of aerobic respiration positive regulation of neuroblast proliferation dopaminergic neuron differentiation lactate metabolic process GO 0009373 regulation of transcription DNA templated blood vessel morphogenesis positive regulation of erythrocyte differentiation glucose homeostasis vascular endothelial growth factor production regulation of thymocyte apoptotic process positive regulation of epithelial cell migration negative regulation of thymocyte apoptotic process transcription DNA templated GO 0060469 GO 0009371 positive regulation of transcription DNA templated axonal transport of mitochondrion positive regulation of macroautophagy cartilage development positive regulation of nitric oxide synthase activity regulation of transcription from RNA polymerase II promoter in response to hypoxia laktaciya negative regulation of oxidative stress induced neuron intrinsic apoptotic signaling pathway positive regulation of pri miRNA transcription by RNA polymerase II digestive tract morphogenesis diferenciaciya klitin neural fold elevation formation positive regulation of autophagy retina vasculature development in camera type eye collagen metabolic process embryonic placenta development negative regulation of apoptotic process positive regulation of angiogenesis regulation of glycolytic process Epitelialno mezenhimalnij perehid cerebral cortex development regulyaciya ekspresiyi geniv positive regulation of chemokine production intestinal epithelial cell maturation GO 0048552 regulation of catalytic activity positive regulation of autophagy of mitochondrion cardiac ventricle morphogenesis response to muscle activity epithelial cell differentiation involved in mammary gland alveolus development visual learning positive regulation of vascular endothelial growth factor receptor signaling pathway negative regulation of bone mineralization negative regulation of growth response to hypoxia positive regulation of endothelial cell proliferation regulation of transcription from RNA polymerase II promoter in response to oxidative stress iris morphogenesis mRNA transcription by RNA polymerase II hypoxia inducible factor 1alpha signaling pathway vasculature development regulation of cell population proliferation neural crest cell migration embryonic hemopoiesis connective tissue replacement involved in inflammatory response wound healing positive regulation of transcription from RNA polymerase II promoter in response to hypoxia negative regulation of reactive oxygen species metabolic process positive regulation of vascular endothelial growth factor production elastin metabolic process positive regulation of glycolytic process oxygen homeostasis GO 0072468 signalna transdukciya GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II cellular iron ion homeostasis camera type eye morphogenesis cellular response to hypoxia cellular response to interleukin 1 transcription by RNA polymerase II protein deubiquitination posttranslyacijna modifikaciya response to iron ion negative regulation of gene expression positive regulation of blood vessel endothelial cell migration GO 1901313 positive regulation of gene expression cytokine mediated signaling pathway GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II Ubikvitin zalezhnij proteolizDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3091 15251Ensembl ENSG00000100644 ENSMUSG00000021109UniProt Q16665 Q61221RefSeq mRNK NM 181054 NM 001243084 NM 001530NM 010431 NM 001313919 NM 001313920RefSeq bilok NP 001230013 NP 001521 NP 851397 NP 001521 1NP 001300848 NP 001300849 NP 034561Lokus UCSC Hr 14 61 7 61 75 MbHr 12 73 95 73 99 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNV SSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFV MVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTH RNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHV YDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDM KFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDL IFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLL APAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAM SPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPS PSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPF STQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKE TTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT VPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSL SWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDC EVNAPIQGSRNLLQGEELLRALDQVN A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Ye osnovnim faktorom indukovanim gipoksiyeyu Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u citoplazmi yadri LiteraturaWang G L Jiang B H Rue E A Semenza G L 1995 Hypoxia inducible factor 1 is a basic helix loop helix PAS heterodimer regulated by cellular O2 tension Proc Natl Acad Sci U S A 92 5510 5514 PMID 7539918 DOI 10 1073 pnas 92 12 5510 Iyer N V Leung S W Semenza G L 1998 The human hypoxia inducible factor 1alpha gene HIF1A structure and evolutionary conservation Genomics 52 159 165 PMID 9782081 DOI 10 1006 geno 1998 5416 Lukashev D Sitkovsky M 2008 Preferential expression of the novel alternative isoform I 3 of hypoxia inducible factor 1alpha in activated human T lymphocytes Hum Immunol 69 421 425 PMID 18638657 DOI 10 1016 j humimm 2008 05 004 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Jiang B H Zheng J Z Leung S W Roe R Semenza G L 1997 Transactivation and inhibitory domains of hypoxia inducible factor 1alpha Modulation of transcriptional activity by oxygen tension J Biol Chem 272 19253 19260 PMID 9235919 DOI 10 1074 jbc 272 31 19253 Huang L E Gu J Schau M Bunn H F 1998 Regulation of hypoxia inducible factor 1alpha is mediated by an O2 dependent degradation domain via the ubiquitin proteasome pathway Proc Natl Acad Sci U S A 95 7987 7992 PMID 9653127 DOI 10 1073 pnas 95 14 7987PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4910 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 13 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 14 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ