HEY1 (англ. Hes related family bHLH transcription factor with YRPW motif 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми. Довжина поліпептидного ланцюга білка становить 304 амінокислот, а молекулярна маса — 32 613.
HEY1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | HEY1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, OAF1, hHRT1, hes related family bHLH transcription factor with YRPW motif 1, NERP2 | ||||||||||||||||
Зовнішні ІД | OMIM: 602953 MGI: 1341800 HomoloGene: 7756 GeneCards: HEY1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 8: 79.76 – 79.77 Mb | Хр. 3: 8.73 – 8.73 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MKRAHPEYSS | SDSELDETIE | VEKESADENG | NLSSALGSMS | PTTSSQILAR | ||||
KRRRGIIEKR | RRDRINNSLS | ELRRLVPSAF | EKQGSAKLEK | AEILQMTVDH | ||||
LKMLHTAGGK | GYFDAHALAM | DYRSLGFREC | LAEVARYLSI | IEGLDASDPL | ||||
RVRLVSHLNN | YASQREAASG | AHAGLGHIPW | GTVFGHHPHI | AHPLLLPQNG | ||||
HGNAGTTASP | TEPHHQGRLG | SAHPEAPALR | APPSGSLGPV | LPVVTSASKL | ||||
SPPLLSSVAS | LSAFPFSFGS | FHLLSPNALS | PSAPTQAANL | GKPYRPWGTE | ||||
IGAF |
Кодований геном білок за функціями належить до репресорів, . Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.
Література
- Kokubo H., Lun Y., Johnson R.L. (1999). Identification and expression of a novel family of bHLH cDNAs related to Drosophila hairy and enhancer of split. Biochem. Biophys. Res. Commun. 260: 459—465. PMID 10403790 DOI:10.1006/bbrc.1999.0880
- Leimeister C., Externbrinck A., Klamt B., Gessler M. (1999). Hey genes: a novel subfamily of hairy- and enhancer of split related genes specifically expressed during mouse embryogenesis. Mech. Dev. 85: 173—177. PMID 10415358 DOI:10.1016/S0925-4773(99)00080-5
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:4880 (англ.) . Процитовано 7 вересня 2017.
- UniProt, Q9Y5J3 (англ.) . Архів оригіналу за 22 вересня 2017. Процитовано 7 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
HEY1 angl Hes related family bHLH transcription factor with YRPW motif 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 8 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 304 aminokislot a molekulyarna masa 32 613 HEY1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2DB7IdentifikatoriSimvoliHEY1 BHLHb31 CHF2 HERP2 HESR1 HRT 1 OAF1 hHRT1 hes related family bHLH transcription factor with YRPW motif 1 NERP2Zovnishni ID OMIM 602953 MGI 1341800 HomoloGene 7756 GeneCards HEY1Ontologiya genaMolekulyarna funkciya microsatellite binding DNA binding protein dimerization activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity transcription factor binding GO 0000983 RNA polymerase II general transcription initiation factor activity GO 0001948 GO 0016582 protein binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific RNA polymerase II transcription regulatory region sequence specific DNA binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific GO 0001106 transcription corepressor activity sequence specific DNA binding sequence specific double stranded DNA bindingKlitinna komponenta citoplazma nukleoplazma klitinne yadroBiologichnij proces dorsal aorta morphogenesis pulmonary valve morphogenesis negative regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation GO 0009373 regulation of transcription DNA templated heart trabecula formation regulation of vasculogenesis cardiac septum morphogenesis ventricular septum morphogenesis labyrinthine layer blood vessel development GO 1901227 negative regulation of transcription by RNA polymerase II transcription DNA templated endocardial cushion morphogenesis multicellular organism development atrioventricular valve formation arterial endothelial cell differentiation cellular response to glucocorticoid stimulus umbilical cord morphogenesis negative regulation of transcription regulatory region DNA binding Angiogenez GO 0045996 negative regulation of transcription DNA templated cardiac ventricle morphogenesis GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of Notch signaling pathway cardiac epithelial to mesenchymal transition Notch signaling involved in heart development Signalnij shlyah Notch GO 0060469 GO 0009371 positive regulation of transcription DNA templated blood vessel development heart development diferenciaciya klitin regulation of neurogenesis GO 1901313 positive regulation of gene expression negative regulation of biomineral tissue development anterior posterior pattern specification negative regulation of neuron differentiation circulatory system developmentDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez23462 15213Ensembl ENSG00000164683 ENSMUSG00000040289UniProt Q9Y5J3 Q9WV93 Q9QUM5RefSeq mRNK NM 012258 NM 001040708 NM 001282851NM 010423RefSeq bilok NP 001035798 NP 001269780 NP 036390NP 034553Lokus UCSC Hr 8 79 76 79 77 MbHr 3 8 73 8 73 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILAR KRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDH LKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPL RVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNG HGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKL SPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE IGAF A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaKokubo H Lun Y Johnson R L 1999 Identification and expression of a novel family of bHLH cDNAs related to Drosophila hairy and enhancer of split Biochem Biophys Res Commun 260 459 465 PMID 10403790 DOI 10 1006 bbrc 1999 0880 Leimeister C Externbrinck A Klamt B Gessler M 1999 Hey genes a novel subfamily of hairy and enhancer of split related genes specifically expressed during mouse embryogenesis Mech Dev 85 173 177 PMID 10415358 DOI 10 1016 S0925 4773 99 00080 5 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4880 angl Procitovano 7 veresnya 2017 UniProt Q9Y5J3 angl Arhiv originalu za 22 veresnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 8 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi