Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

FKBP1A англ FK506 binding protein 1A білок який кодується однойменним геном розташованим у людей на короткому плечі 20 ї

FKBP1A

FKBP1A

FKBP1A (англ. FK506 binding protein 1A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 108 амінокислот, а молекулярна маса — 11 951.

FKBP1A
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FKBP1A, FKBP-12, FKBP-1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE, FK506 binding protein 1A, FKBP prolyl isomerase 1A
Зовнішні ІД OMIM: 186945 MGI: 95541 HomoloGene: 105139 GeneCards: FKBP1A
Реагує на сполуку
сиролімус, такролімус, zotarolimus
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
2280
14225
Ensembl
ENSG00000088832
ENSMUSG00000032966
UniProt
P62942
P26883
RefSeq (мРНК)
NM_054014
NM_000801
NM_001199786
RefSeq (білок)
NP_000792
NP_001186715
NP_463460
Локус (UCSC) Хр. 20: 1.37 – 1.39 Mb Хр. 2: 151.38 – 151.4 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFM
LGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVF
DVELLKLE

Кодований геном білок за функціями належить до ізомераз, . Задіяний у такому біологічному процесі, як ацетилювання. Локалізований у цитоплазмі, мембрані, саркоплазматичному ретикулумі.

Література

  • Standaert R.F., Galat A., Verdine G.L., Schreiber S.L. (1990). Molecular cloning and overexpression of the human FK506-binding protein FKBP. Nature. 346: 671—674. PMID 1696686 DOI:10.1038/346671a0
  • Dilella A.G., Craig R.J. (1991). Exon organization of the human FKBP-12 gene: correlation with structural and functional protein domains. Biochemistry. 30: 8512—8517. PMID 1716149 DOI:10.1021/bi00099a002
  • Peattie D.A., Hsiao K., Benasutti M., Lippke J.A. (1994). Three distinct messenger RNAs can encode the human immunosuppressant-binding protein FKBP12. Gene. 150: 251—257. PMID 7529739 DOI:10.1016/0378-1119(94)90434-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Harding M.W., Galat A., Uehling D.E., Schreiber S.L. (1989). A receptor for the immunosuppressant FK506 is a cis-trans peptidyl-prolyl isomerase. Nature. 341: 758—760. PMID 2477715 DOI:10.1038/341758a0
  • Chen Y.G., Liu F., Massague J. (1997). Mechanism of TGFbeta receptor inhibition by FKBP12. EMBO J. 16: 3866—3876. PMID 9233797 DOI:10.1093/emboj/16.13.3866

Примітки

  1. Сполуки, які фізично взаємодіють з FKBP prolyl isomerase 1A переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 14 жовтня 2017. Процитовано 12 вересня 2017.
  5. (англ.) . Архів оригіналу за 3 жовтня 2017. Процитовано 12 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

FKBP1A angl FK506 binding protein 1A bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 108 aminokislot a molekulyarna masa 11 951 FKBP1ANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1A7X 1B6C 1BKF 1BL4 1D6O 1D7H 1D7I 1D7J 1EYM 1F40 1FAP 1FKB 1FKD 1FKF 1FKG 1FKH 1FKI 1FKJ 1FKR 1FKS 1FKT 1J4H 1J4I 1J4R 1NSG 1QPF 1QPL 2DG3 2DG4 2DG9 2FAP 2FKE 2PPN 2PPO 2PPP 2RSE 3FAP 3H9R 3MDY 4DH0 4FAP 4IPX 4N19 4ODP 4ODQ 4ODRIdentifikatoriSimvoliFKBP1A FKBP 12 FKBP 1A FKBP1 FKBP12 PKC12 PKCI2 PPIASE FK506 binding protein 1A FKBP prolyl isomerase 1AZovnishni ID OMIM 186945 MGI 95541 HomoloGene 105139 GeneCards FKBP1AReaguye na spolukusirolimus takrolimus zotarolimus Ontologiya genaMolekulyarna funkciya calcium channel inhibitor activity activin binding isomerase activity macrolide binding peptidyl prolyl cis trans isomerase activity signal transducer activity GO 0001948 GO 0016582 protein binding SMAD binding transforming growth factor beta receptor binding FK506 binding enzyme binding Hsp70 protein binding type I transforming growth factor beta receptor binding protein homodimerization activity transmembrane transporter bindingKlitinna komponenta citoplazma terminal cisterna Z disc ekzosoma extrinsic component of organelle membrane cytoplasmic side of membrane ryanodine receptor complex gialoplazma membrana sarcoplasmic reticulum sarcoplasmic reticulum membrane vnutrishnoklitinna membranna organela axon terminusBiologichnij proces SMAD protein complex assembly amyloid fibril formation regulation of activin receptor signaling pathway protein maturation by protein folding regulation of amyloid precursor protein catabolic process protein peptidyl prolyl isomerization negative regulation of ryanodine sensitive calcium release channel activity regulation of protein localization calcium ion transmembrane transport protein refolding regulation of immune response positive regulation of I kappaB kinase NF kappaB signaling negative regulation of release of sequestered calcium ion into cytosol positive regulation of protein binding positive regulation of protein ubiquitination de novo protein folding transforming growth factor beta receptor signaling pathway T cell activation chaperone mediated protein folding supramolecular fiber organization negative regulation of phosphoprotein phosphatase activity zgortannya bilkiv GO 0033128 negative regulation of protein phosphorylation heart morphogenesis m yazove skorochennya response to iron ion cytokine mediated signaling pathway response to caffeine T cell proliferation release of sequestered calcium ion into cytosol ventricular cardiac muscle tissue morphogenesis regulation of ryanodine sensitive calcium release channel activity heart trabecula formationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2280 14225Ensembl ENSG00000088832 ENSMUSG00000032966UniProt P62942 P26883RefSeq mRNK NM 054014 NM 000801 NM 001199786NM 001302077 NM 001302078 NM 001302079 NM 001302080 NM 008019NM 001355077 NM 001355078RefSeq bilok NP 000792 NP 001186715 NP 463460NP 001289006 NP 001289007 NP 001289008 NP 001289009 NP 032045NP 001342006 NP 001342007Lokus UCSC Hr 20 1 37 1 39 MbHr 2 151 38 151 4 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFM LGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVF DVELLKLE A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do izomeraz Zadiyanij u takomu biologichnomu procesi yak acetilyuvannya Lokalizovanij u citoplazmi membrani sarkoplazmatichnomu retikulumi LiteraturaStandaert R F Galat A Verdine G L Schreiber S L 1990 Molecular cloning and overexpression of the human FK506 binding protein FKBP Nature 346 671 674 PMID 1696686 DOI 10 1038 346671a0 Dilella A G Craig R J 1991 Exon organization of the human FKBP 12 gene correlation with structural and functional protein domains Biochemistry 30 8512 8517 PMID 1716149 DOI 10 1021 bi00099a002 Peattie D A Hsiao K Benasutti M Lippke J A 1994 Three distinct messenger RNAs can encode the human immunosuppressant binding protein FKBP12 Gene 150 251 257 PMID 7529739 DOI 10 1016 0378 1119 94 90434 0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Harding M W Galat A Uehling D E Schreiber S L 1989 A receptor for the immunosuppressant FK506 is a cis trans peptidyl prolyl isomerase Nature 341 758 760 PMID 2477715 DOI 10 1038 341758a0 Chen Y G Liu F Massague J 1997 Mechanism of TGFbeta receptor inhibition by FKBP12 EMBO J 16 3866 3876 PMID 9233797 DOI 10 1093 emboj 16 13 3866PrimitkiSpoluki yaki fizichno vzayemodiyut z FKBP prolyl isomerase 1A pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 14 zhovtnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 3 zhovtnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 20 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ