Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
FCGR2B (англ. Fc fragment of IgG receptor IIb) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 310 амінокислот, а молекулярна маса — 34 044.
| FCGR2B | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | FCGR2B, CD32, CD32B, FCG2, FCGR2, IGFR2, Fc fragment of IgG receptor IIb, FcRII-c, FCGR2C | ||||||||||||||||
| Зовнішні ІД | OMIM: 604590 MGI: 95499 HomoloGene: 2974 GeneCards: FCGR2B | ||||||||||||||||
| |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 1: 161.66 – 161.68 Mb | Хр. 1: 170.79 – 170.8 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MGILSFLPVL | ATESDWADCK | SPQPWGHMLL | WTAVLFLAPV | AGTPAAPPKA | ||||
| VLKLEPQWIN | VLQEDSVTLT | CRGTHSPESD | SIQWFHNGNL | IPTHTQPSYR | ||||
| FKANNNDSGE | YTCQTGQTSL | SDPVHLTVLS | EWLVLQTPHL | EFQEGETIVL | ||||
| RCHSWKDKPL | VKVTFFQNGK | SKKFSRSDPN | FSIPQANHSH | SGDYHCTGNI | ||||
| GYTLYSSKPV | TITVQAPSSS | PMGIIVAVVT | GIAVAAIVAA | VVALIYCRKK | ||||
| RISALPGYPE | CREMGETLPE | KPANPTNPDE | ADKVGAENTI | TYSLLMHPDA | ||||
| LEEPDDQNRI |
Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані.
Література
- Brooks D.G., Qiu W.Q., Luster A.D., Ravetch J.V. (1989). Structure and expression of human IgG FcRII(CD32). Functional heterogeneity is encoded by the alternatively spliced products of multiple genes. J. Exp. Med. 170: 1369—1385. PMID 2529342 DOI:10.1084/jem.170.4.1369
- Engelhardt W., Geerds C., Frey J. (1990). Distribution, inducibility and biological function of the cloned and expressed human beta Fc receptor II. Eur. J. Immunol. 20: 1367—1377. PMID 2142460 DOI:10.1002/eji.1830200624
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Hamada F., Aoki M., Akiyama T., Toyoshima K. (1993). Association of immunoglobulin G Fc receptor II with Src-like protein-tyrosine kinase Fgr in neutrophils. Proc. Natl. Acad. Sci. U.S.A. 90: 6305—6309. PMID 8327512 DOI:10.1073/pnas.90.13.6305
- Sarmay G., Koncz G., Pecht I., Gergely J. (1997). Fc gamma receptor type IIb induced recruitment of inositol and protein phosphatases to the signal transductory complex of human B-cell. Immunol. Lett. 57: 159—164. PMID 9232445 DOI:10.1016/S0165-2478(97)00055-2
- Sondermann P., Huber R., Jacob U. (1999). Crystal structure of the soluble form of the human fcgamma-receptor IIb: a new member of the immunoglobulin superfamily at 1.7 A resolution. EMBO J. 18: 1095—1103. PMID 10064577 DOI:10.1093/emboj/18.5.1095
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:3618 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 8 жовтня 2017. Процитовано 12 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FCGR2B angl Fc fragment of IgG receptor IIb bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 310 aminokislot a molekulyarna masa 34 044 FCGR2BNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2FCB 3WJJ s3WJLIdentifikatoriSimvoliFCGR2B CD32 CD32B FCG2 FCGR2 IGFR2 Fc fragment of IgG receptor IIb FcRII c FCGR2CZovnishni ID OMIM 604590 MGI 95499 HomoloGene 2974 GeneCards FCGR2BOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding IgG binding amyloid beta binding low affinity IgG receptor activity GO 0032403 protein containing complex binding transmembrane signaling receptor activityKlitinna komponenta integral component of membrane klitinna membrana membrana integral component of plasma membrane external side of plasma membrane dendritic spine cell body citoplazmaBiologichnij proces GO 0022415 viral process GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid GO 0072468 signalna transdukciya regulation of immune response negative regulation of type I hypersensitivity negative regulation of antibody dependent cellular cytotoxicity follicular dendritic cell activation mature B cell differentiation involved in immune response follicular B cell differentiation immune complex clearance by monocytes and macrophages negative regulation of dendritic cell antigen processing and presentation regulation of B cell antigen processing and presentation negative regulation of immunoglobulin production regulation of adaptive immune response negative regulation of acute inflammatory response to antigenic stimulus positive regulation of humoral immune response negative regulation of humoral immune response mediated by circulating immunoglobulin receptor oposeredkovanij endocitoz phagocytosis engulfment defense response inflammatory response response to bacterium regulation of signaling receptor activity immunoglobulin mediated immune response antigen processing and presentation of exogenous peptide antigen via MHC class II cerebellum development negative regulation of B cell proliferation negative regulation of interleukin 10 production Fc gamma receptor signaling pathway involved in phagocytosis negative regulation of macrophage activation negative regulation of cytotoxic T cell degranulation regulation of innate immune response mast cell activation positive regulation of JNK cascade negative regulation of phagocytosis positive regulation of phagocytosis negative regulation of immune response negative regulation of B cell receptor signaling pathway negative regulation of B cell activation cellular response to molecule of bacterial origin regulation of immune complex clearance by monocytes and macrophages positive regulation of neuron death negative regulation of neutrophil activation regulation of dendritic spine maintenance cellular response to amyloid beta positive regulation of response to endoplasmic reticulum stress negative regulation of dendritic cell differentiationDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez2213 14130Ensembl ENSG00000072694 ENSMUSG00000026656UniProt P31994 P31995 P08101RefSeq mRNK NM 001002273 NM 001002274 NM 001002275 NM 001190828 NM 004001NM 001077189 NM 010187RefSeq bilok NP 001002273 NP 001002274 NP 001002275 NP 001177757 NP 003992NP 963857NP 001070657 NP 034317Lokus UCSC Hr 1 161 66 161 68 MbHr 1 170 79 170 8 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKA VLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYR FKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVL RCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNI GYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKK RISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA LEEPDDQNRI A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak vzayemodiya hazyayin virus alternativnij splajsing Lokalizovanij u klitinnij membrani membrani LiteraturaBrooks D G Qiu W Q Luster A D Ravetch J V 1989 Structure and expression of human IgG FcRII CD32 Functional heterogeneity is encoded by the alternatively spliced products of multiple genes J Exp Med 170 1369 1385 PMID 2529342 DOI 10 1084 jem 170 4 1369 Engelhardt W Geerds C Frey J 1990 Distribution inducibility and biological function of the cloned and expressed human beta Fc receptor II Eur J Immunol 20 1367 1377 PMID 2142460 DOI 10 1002 eji 1830200624 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hamada F Aoki M Akiyama T Toyoshima K 1993 Association of immunoglobulin G Fc receptor II with Src like protein tyrosine kinase Fgr in neutrophils Proc Natl Acad Sci U S A 90 6305 6309 PMID 8327512 DOI 10 1073 pnas 90 13 6305 Sarmay G Koncz G Pecht I Gergely J 1997 Fc gamma receptor type IIb induced recruitment of inositol and protein phosphatases to the signal transductory complex of human B cell Immunol Lett 57 159 164 PMID 9232445 DOI 10 1016 S0165 2478 97 00055 2 Sondermann P Huber R Jacob U 1999 Crystal structure of the soluble form of the human fcgamma receptor IIb a new member of the immunoglobulin superfamily at 1 7 A resolution EMBO J 18 1095 1103 PMID 10064577 DOI 10 1093 emboj 18 5 1095PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3618 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 8 zhovtnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi