F2RL1 (англ. F2R like trypsin receptor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. Довжина поліпептидного ланцюга білка становить 397 амінокислот, а молекулярна маса — 44 126.
F2RL1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | F2RL1, GPR11, PAR2, Protease activated receptor 2, F2R like trypsin receptor 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 600933 MGI: 101910 HomoloGene: 21087 GeneCards: F2RL1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 5: 76.82 – 76.84 Mb | Хр. 13: 95.65 – 95.66 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MRSPSAAWLL | GAAILLAASL | SCSGTIQGTN | RSSKGRSLIG | KVDGTSHVTG | ||||
KGVTVETVFS | VDEFSASVLT | GKLTTVFLPI | VYTIVFVVGL | PSNGMALWVF | ||||
LFRTKKKHPA | VIYMANLALA | DLLSVIWFPL | KIAYHIHGNN | WIYGEALCNV | ||||
LIGFFYGNMY | CSILFMTCLS | VQRYWVIVNP | MGHSRKKANI | AIGISLAIWL | ||||
LILLVTIPLY | VVKQTIFIPA | LNITTCHDVL | PEQLLVGDMF | NYFLSLAIGV | ||||
FLFPAFLTAS | AYVLMIRMLR | SSAMDENSEK | KRKRAIKLIV | TVLAMYLICF | ||||
TPSNLLLVVH | YFLIKSQGQS | HVYALYIVAL | CLSTLNSCID | PFVYYFVSHD | ||||
FRDHAKNALL | CRSVRTVKQM | QVSLTSKKHS | RKSSSYSSSS | TTVKTSY |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, , фосфопротеїнів. Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, запальна відповідь, поліморфізм. Локалізований у клітинній мембрані, мембрані.
Література
- Nystedt S., Emilsson K., Larsson A.-K., Stroembeck B., Sundelin J. (1995). Molecular cloning and functional expression of the gene encoding the human proteinase-activated receptor 2. Eur. J. Biochem. 232: 84—89. PMID 7556175 doi:10.1111/j.1432-1033.1995.tb20784.x
- Luo W., Wang Y., Hanck T., Stricker R., Reiser G. (2006). Jab1, a novel protease-activated receptor-2 (PAR-2)-interacting protein, is involved in PAR-2-induced activation of activator protein-1. J. Biol. Chem. 281: 7927—7936. PMID 16410250 doi:10.1074/jbc.M510784200
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 doi:10.1101/gr.2596504
- Camerer E., Huang W., Coughlin S.R. (2000). Tissue factor- and factor X-dependent activation of protease-activated receptor 2 by factor VIIa. Proc. Natl. Acad. Sci. U.S.A. 97: 5255—5260. PMID 10805786 doi:10.1073/pnas.97.10.5255
- Sun G., Stacey M.A., Schmidt M., Mori L., Mattoli S. (2001). Interaction of mite allergens Der p3 and Der p9 with protease-activated receptor-2 expressed by lung epithelial cells. J. Immunol. 167: 1014—1021. PMID 11441110 doi:10.4049/jimmunol.167.2.1014
- Miike S., McWilliam A.S., Kita H. (2001). Trypsin induces activation and inflammatory mediator release from human eosinophils through protease-activated receptor-2. J. Immunol. 167: 6615—6622. PMID 11714832 doi:10.4049/jimmunol.167.11.6615
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:3538 (англ.) . Архів оригіналу за 12 вересня 2015. Процитовано 31 серпня 2017. [Архівовано 2015-09-12 у Wayback Machine.]
- UniProt, P55085 (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 31 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
F2RL1 angl F2R like trypsin receptor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 397 aminokislot a molekulyarna masa 44 126 F2RL1IdentifikatoriSimvoliF2RL1 GPR11 PAR2 Protease activated receptor 2 F2R like trypsin receptor 1Zovnishni ID OMIM 600933 MGI 101910 HomoloGene 21087 GeneCards F2RL1Ontologiya genaMolekulyarna funkciya G protein coupled receptor activity signal transducer activity thrombin activated receptor activity G protein beta subunit binding GO 0001948 GO 0016582 protein binding G protein alpha subunit binding signaling receptor binding signaling receptor activityKlitinna komponenta integral component of membrane kompleks Goldzhi Psevdopodiya membrana klitinna membrana integral component of plasma membrane early endosomeBiologichnij proces positive regulation of Rho protein signal transduction establishment of endothelial barrier thrombin activated receptor signaling pathway neutrophil activation positive regulation of phagocytosis engulfment positive regulation of toll like receptor 3 signaling pathway positive regulation of eosinophil degranulation positive regulation of neutrophil mediated killing of gram negative bacterium negative regulation of tumor necrosis factor mediated signaling pathway proces imunnoyi sistemi positive regulation of cell migration positive regulation of cytosolic calcium ion concentration zsidannya krovi positive regulation of JNK cascade positive regulation of leukocyte chemotaxis negative regulation of JNK cascade leukocyte proliferation regulation of JNK cascade positive regulation of pseudopodium assembly positive regulation of renin secretion into blood stream defense response to virus positive regulation of chemotaxis positive regulation of ERK1 and ERK2 cascade positive regulation of toll like receptor 4 signaling pathway positive regulation of I kappaB kinase NF kappaB signaling positive regulation of toll like receptor 2 signaling pathway positive regulation of phosphatidylinositol 3 kinase signaling positive regulation of superoxide anion generation positive regulation of glomerular filtration regulation of blood coagulation inflammatory response vrodzhenij imunitet mature conventional dendritic cell differentiation negative regulation of toll like receptor 3 signaling pathway positive regulation of actin filament depolymerization leukocyte migration regulation of I kappaB kinase NF kappaB signaling GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of positive chemotaxis GO 0072468 signalna transdukciya T cell activation involved in immune response positive regulation of cytosolic calcium ion concentration involved in phospholipase C activating G protein coupled signaling pathway G protein coupled receptor signaling pathway GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity cell cell junction maintenanceDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2150 14063Ensembl ENSG00000164251 ENSMUSG00000021678UniProt P55085 P55086RefSeq mRNK NM 005242NM 007974RefSeq bilok NP 005233NP 032000Lokus UCSC Hr 5 76 82 76 84 MbHr 13 95 65 95 66 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTG KGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVF LFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNV LIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWL LILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGV FLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHD FRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet zapalna vidpovid polimorfizm Lokalizovanij u klitinnij membrani membrani LiteraturaNystedt S Emilsson K Larsson A K Stroembeck B Sundelin J 1995 Molecular cloning and functional expression of the gene encoding the human proteinase activated receptor 2 Eur J Biochem 232 84 89 PMID 7556175 doi 10 1111 j 1432 1033 1995 tb20784 x Luo W Wang Y Hanck T Stricker R Reiser G 2006 Jab1 a novel protease activated receptor 2 PAR 2 interacting protein is involved in PAR 2 induced activation of activator protein 1 J Biol Chem 281 7927 7936 PMID 16410250 doi 10 1074 jbc M510784200 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 doi 10 1101 gr 2596504 Camerer E Huang W Coughlin S R 2000 Tissue factor and factor X dependent activation of protease activated receptor 2 by factor VIIa Proc Natl Acad Sci U S A 97 5255 5260 PMID 10805786 doi 10 1073 pnas 97 10 5255 Sun G Stacey M A Schmidt M Mori L Mattoli S 2001 Interaction of mite allergens Der p3 and Der p9 with protease activated receptor 2 expressed by lung epithelial cells J Immunol 167 1014 1021 PMID 11441110 doi 10 4049 jimmunol 167 2 1014 Miike S McWilliam A S Kita H 2001 Trypsin induces activation and inflammatory mediator release from human eosinophils through protease activated receptor 2 J Immunol 167 6615 6622 PMID 11714832 doi 10 4049 jimmunol 167 11 6615PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 3538 angl Arhiv originalu za 12 veresnya 2015 Procitovano 31 serpnya 2017 Arhivovano 2015 09 12 u Wayback Machine UniProt P55085 angl Arhiv originalu za 25 serpnya 2017 Procitovano 31 serpnya 2017 Div takozhHromosoma 5 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi