DCN (англ. Decorin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 359 амінокислот, а молекулярна маса — 39 747.
DCN | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | DCN, Dcn, DC, DSPG2, PG40, PGII, PGS2, SLRR1B, mDcn, CSCD, decorin | ||||||||||||||||
Зовнішні ІД | OMIM: 125255 MGI: 94872 HomoloGene: 22430 GeneCards: DCN | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
congenital stromal corneal dystrophy | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 91.14 – 91.18 Mb | Хр. 10: 97.32 – 97.35 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MKATIILLLL | AQVSWAGPFQ | QRGLFDFMLE | DEASGIGPEV | PDDRDFEPSL | ||||
GPVCPFRCQC | HLRVVQCSDL | GLDKVPKDLP | PDTTLLDLQN | NKITEIKDGD | ||||
FKNLKNLHAL | ILVNNKISKV | SPGAFTPLVK | LERLYLSKNQ | LKELPEKMPK | ||||
TLQELRAHEN | EITKVRKVTF | NGLNQMIVIE | LGTNPLKSSG | IENGAFQGMK | ||||
KLSYIRIADT | NITSIPQGLP | PSLTELHLDG | NKISRVDAAS | LKGLNNLAKL | ||||
GLSFNSISAV | DNGSLANTPH | LRELHLDNNK | LTRVPGGLAE | HKYIQVVYLH | ||||
NNNISVVGSS | DFCPPGHNTK | KASYSGVSLF | SNPVQYWEIQ | PSTFRCVYVR | ||||
SAIQLGNYK |
Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Локалізований у позаклітинному матриксі. Також секретований назовні.
Література
- Krusius T., Ruoslahti E. (1986). Primary structure of an extracellular matrix proteoglycan core protein deduced from cloned cDNA. Proc. Natl. Acad. Sci. U.S.A. 83: 7683—7687. PMID 3484330 DOI:10.1073/pnas.83.20.7683
- Vetter U., Vogel W., Just W., Young M.F., Fisher L.W. (1993). Human decorin gene: intron-exon junctions and chromosomal localization. Genomics. 15: 161—168. PMID 8432527 DOI:10.1006/geno.1993.1023
- Danielson K.G., Fazzio A., Cohen I.R., Cannizzaro L., Iozzo R.V. (1993). The human decorin gene: intron-exon organization, discovery of two alternatively spliced exons in the 5' untranslated region, and mapping of the gene to chromosome 12q23. Genomics. 15: 146—160. PMID 8432526 DOI:10.1006/geno.1993.1022
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Roughley P.J., White R.J. (1989). Dermatan sulphate proteoglycans of human articular cartilage. The properties of dermatan sulphate proteoglycans I and II. Biochem. J. 262: 823—827. PMID 2590169 DOI:10.1042/bj2620823
- Bredrup C., Knappskog P.M., Majewski J., Rodahl E., Boman H. (2005). Congenital stromal dystrophy of the cornea caused by a mutation in the decorin gene. Invest. Ophthalmol. Vis. Sci. 46: 420—426. PMID 15671264 DOI:10.1167/iovs.04-0804
Примітки
- Захворювання, генетично пов'язані з DCN переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 1 вересня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
DCN angl Decorin bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 359 aminokislot a molekulyarna masa 39 747 DCNIdentifikatoriSimvoliDCN Dcn DC DSPG2 PG40 PGII PGS2 SLRR1B mDcn CSCD decorinZovnishni ID OMIM 125255 MGI 94872 HomoloGene 22430 GeneCards DCNPov yazani genetichni zahvoryuvannyacongenital stromal corneal dystrophy Ontologiya genaMolekulyarna funkciya collagen binding protein N terminus binding protein kinase inhibitor activity glycosaminoglycan binding extracellular matrix binding GO 0001948 GO 0016582 protein binding RNA binding extracellular matrix structural constituent conferring compression resistanceKlitinna komponenta citoplazma GO 0005578 Pozaklitinna matricya lysosomal lumen Golgi lumen collagen type VI trimer mizhklitinnij prostir extracellular region collagen containing extracellular matrixBiologichnij proces glycosaminoglycan metabolic process positive regulation of mitochondrial fission negative regulation of protein kinase activity positive regulation of autophagy rozvitok nirki cytokine mediated signaling pathway placenta development chondroitin sulfate biosynthetic process response to mechanical stimulus GO 0010260 starinnya lyudini extracellular matrix disassembly extracellular matrix organization Zagoyennya ran negative regulation of endothelial cell migration positive regulation of macroautophagy response to lipopolysaccharide positive regulation of mitochondrial depolarization animal organ morphogenesis chondroitin sulfate catabolic process negative regulation of angiogenesis positive regulation of phosphatidylinositol 3 kinase signaling peptide cross linking via chondroitin 4 sulfate glycosaminoglycan negative regulation of vascular endothelial growth factor signaling pathway dermatan sulfate biosynthetic process skeletal muscle tissue development GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of receptor signaling pathway via JAK STATDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1634 13179Ensembl ENSG00000011465 ENSMUSG00000019929UniProt P07585 P28654RefSeq mRNK NM 001920 NM 133503 NM 133504 NM 133505 NM 133506NM 133507NM 001190451 NM 007833RefSeq bilok NP 001911 NP 598010 NP 598011 NP 598012 NP 598013NP 598014NP 001177380 NP 031859Lokus UCSC Hr 12 91 14 91 18 MbHr 10 97 32 97 35 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSL GPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGD FKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPK TLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMK KLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKL GLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVR SAIQLGNYK A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u pozaklitinnomu matriksi Takozh sekretovanij nazovni LiteraturaKrusius T Ruoslahti E 1986 Primary structure of an extracellular matrix proteoglycan core protein deduced from cloned cDNA Proc Natl Acad Sci U S A 83 7683 7687 PMID 3484330 DOI 10 1073 pnas 83 20 7683 Vetter U Vogel W Just W Young M F Fisher L W 1993 Human decorin gene intron exon junctions and chromosomal localization Genomics 15 161 168 PMID 8432527 DOI 10 1006 geno 1993 1023 Danielson K G Fazzio A Cohen I R Cannizzaro L Iozzo R V 1993 The human decorin gene intron exon organization discovery of two alternatively spliced exons in the 5 untranslated region and mapping of the gene to chromosome 12q23 Genomics 15 146 160 PMID 8432526 DOI 10 1006 geno 1993 1022 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Roughley P J White R J 1989 Dermatan sulphate proteoglycans of human articular cartilage The properties of dermatan sulphate proteoglycans I and II Biochem J 262 823 827 PMID 2590169 DOI 10 1042 bj2620823 Bredrup C Knappskog P M Majewski J Rodahl E Boman H 2005 Congenital stromal dystrophy of the cornea caused by a mutation in the decorin gene Invest Ophthalmol Vis Sci 46 420 426 PMID 15671264 DOI 10 1167 iovs 04 0804PrimitkiZahvoryuvannya genetichno pov yazani z DCN pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 23 veresnya 2017 Procitovano 11 veresnya 2017 angl Arhiv originalu za 1 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi