CXADR (англ. CXADR, Ig-like cell adhesion molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми. Довжина поліпептидного ланцюга білка становить 365 амінокислот, а молекулярна маса — 40 030.
CXADR | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CXADR, CAR, CAR4/6, HCAR, coxsackie virus and adenovirus receptor, Ig-like cell adhesion molecule, CXADR Ig-like cell adhesion molecule | ||||||||||||||||
Зовнішні ІД | OMIM: 602621 MGI: 1201679 HomoloGene: 1024 GeneCards: CXADR | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 21: 17.51 – 17.59 Mb | Хр. 16: 78.1 – 78.16 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MALLLCFVLL | CGVVDFARSL | SITTPEEMIE | KAKGETAYLP | CKFTLSPEDQ | ||||
GPLDIEWLIS | PADNQKVDQV | IILYSGDKIY | DDYYPDLKGR | VHFTSNDLKS | ||||
GDASINVTNL | QLSDIGTYQC | KVKKAPGVAN | KKIHLVVLVK | PSGARCYVDG | ||||
SEEIGSDFKI | KCEPKEGSLP | LQYEWQKLSD | SQKMPTSWLA | EMTSSVISVK | ||||
NASSEYSGTY | SCTVRNRVGS | DQCLLRLNVV | PPSNKAGLIA | GAIIGTLLAL | ||||
ALIGLIIFCC | RKKRREEKYE | KEVHHDIRED | VPPPKSRTST | ARSYIGSNHS | ||||
SLGSMSPSNM | EGYSKTQYNQ | VPSEDFERTP | QSPTLPPAKV | AAPNLSRMGA | ||||
IPVMIPAQSK | DGSIV |
Кодований геном білок за функціями належить до рецепторів клітини-хазяїна для входу вірусу, рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинна адгезія, взаємодія хазяїн-вірус, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних контактах, щільних контактах. Також секретований назовні.
Література
- Tomko R.P., Xu R., Philipson L. (1997). HCAR and MCAR: the human and mouse cellular receptors for subgroup C adenoviruses and group B coxsackieviruses. Proc. Natl. Acad. Sci. U.S.A. 94: 3352—3356. PMID 9096397 DOI:10.1073/pnas.94.7.3352
- Doerner A., Xiong D., Couch K., Yajima T., Knowlton K.U. (2004). Alternatively spliced soluble coxsackie-adenovirus receptors inhibit coxsackievirus infection. J. Biol. Chem. 279: 18497—18503. PMID 14978041 DOI:10.1074/jbc.M311754200
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Cohen C.J., Gaetz J., Ohman T., Bergelson J.M. (2001). Multiple regions within the coxsackievirus and adenovirus receptor cytoplasmic domain are required for basolateral sorting. J. Biol. Chem. 276: 25392—25398. PMID 11316797 DOI:10.1074/jbc.M009531200
- van't Hof W., Crystal R.G. (2002). Fatty acid modification of the coxsackievirus and adenovirus receptor. J. Virol. 76: 6382—6386. PMID 12021372 DOI:10.1128/JVI.76.12.6382-6386.2002
- Coyne C.B., Voelker T., Pichla S.L., Bergelson J.M. (2004). The coxsackievirus and adenovirus receptor interacts with the multi-PDZ domain protein-1 (MUPP-1) within the tight junction. J. Biol. Chem. 279: 48079—48084. PMID 15364909 DOI:10.1074/jbc.M409061200
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:2559 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CXADR angl CXADR Ig like cell adhesion molecule bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 21 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 365 aminokislot a molekulyarna masa 40 030 CXADRNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1EAJ 1F5W 1JEW 1KAC 1P69 1P6A 1RSF 2J12 2J1K 2NPL 2W9L 2WBW 3J6L 3J6M 3J6N 3J6OIdentifikatoriSimvoliCXADR CAR CAR4 6 HCAR coxsackie virus and adenovirus receptor Ig like cell adhesion molecule CXADR Ig like cell adhesion moleculeZovnishni ID OMIM 602621 MGI 1201679 HomoloGene 1024 GeneCards CXADROntologiya genaMolekulyarna funkciya PDZ domain binding beta catenin binding connexin binding virus receptor activity integrin binding GO 0001948 GO 0016582 protein binding identical protein binding signaling receptor binding cell adhesion molecule binding cell adhesive protein binding involved in AV node cell bundle of His cell communicationKlitinna komponenta citoplazma integral component of membrane cell body membrana intercalated disc cell cell junction bicellular tight junction Filopodiya growth cone Adgezivni kontakti neuromuscular junction klitinna membrana integral component of plasma membrane nukleoplazma extracellular region mizhklitinni kontakti apicolateral plasma membrane basolateral plasma membrane Akrosoma membrane raft neuron projection mizhklitinnij prostir GO 0009327 protein containing complexBiologichnij proces actin cytoskeleton reorganization heterophilic cell cell adhesion via plasma membrane cell adhesion molecules cell cell junction organization epithelial structure maintenance AV node cell to bundle of His cell communication gamma delta T cell activation mitochondrion organization neutrophil chemotaxis transepithelial transport homotypic cell cell adhesion heart development adgeziya klitin defense response to virus regulation of immune response viral entry into host cell GO 0022415 viral process leukocyte migration germ cell migration AV node cell bundle of His cell adhesion involved in cell communication regulation of AV node cell action potential negative regulation of cardiac muscle cell proliferation cell cell adhesionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1525 13052Ensembl ENSG00000154639 ENSMUSG00000022865UniProt P78310 P97792RefSeq mRNK NM 001207063 NM 001207064 NM 001207065 NM 001207066 NM 001338NM 001025192 NM 001276263 NM 009988RefSeq bilok NP 001193992 NP 001193993 NP 001193994 NP 001193995 NP 001329NP 001020363 NP 001263192 NP 034118Lokus UCSC Hr 21 17 51 17 59 MbHr 16 78 1 78 16 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQ GPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKS GDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDG SEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVK NASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLAL ALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS SLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGA IPVMIPAQSKDGSIV A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv klitini hazyayina dlya vhodu virusu receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinna adgeziya vzayemodiya hazyayin virus alternativnij splajsing Lokalizovanij u klitinnij membrani membrani klitinnih kontaktah shilnih kontaktah Takozh sekretovanij nazovni LiteraturaTomko R P Xu R Philipson L 1997 HCAR and MCAR the human and mouse cellular receptors for subgroup C adenoviruses and group B coxsackieviruses Proc Natl Acad Sci U S A 94 3352 3356 PMID 9096397 DOI 10 1073 pnas 94 7 3352 Doerner A Xiong D Couch K Yajima T Knowlton K U 2004 Alternatively spliced soluble coxsackie adenovirus receptors inhibit coxsackievirus infection J Biol Chem 279 18497 18503 PMID 14978041 DOI 10 1074 jbc M311754200 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Cohen C J Gaetz J Ohman T Bergelson J M 2001 Multiple regions within the coxsackievirus and adenovirus receptor cytoplasmic domain are required for basolateral sorting J Biol Chem 276 25392 25398 PMID 11316797 DOI 10 1074 jbc M009531200 van t Hof W Crystal R G 2002 Fatty acid modification of the coxsackievirus and adenovirus receptor J Virol 76 6382 6386 PMID 12021372 DOI 10 1128 JVI 76 12 6382 6386 2002 Coyne C B Voelker T Pichla S L Bergelson J M 2004 The coxsackievirus and adenovirus receptor interacts with the multi PDZ domain protein 1 MUPP 1 within the tight junction J Biol Chem 279 48079 48084 PMID 15364909 DOI 10 1074 jbc M409061200PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 2559 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 25 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 21 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi