CTSG (англ. Cathepsin G) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми. Довжина поліпептидного ланцюга білка становить 255 амінокислот, а молекулярна маса — 28 837.
CTSG | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CTSG, CATG, CG, cathepsin G | ||||||||||||||||
Зовнішні ІД | OMIM: 116830 MGI: 88563 HomoloGene: 105646 GeneCards: CTSG | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 14: 24.57 – 24.58 Mb | Хр. 14: 56.34 – 56.34 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MQPLLLLLAF | LLPTGAEAGE | IIGGRESRPH | SRPYMAYLQI | QSPAGQSRCG | ||||
GFLVREDFVL | TAAHCWGSNI | NVTLGAHNIQ | RRENTQQHIT | ARRAIRHPQY | ||||
NQRTIQNDIM | LLQLSRRVRR | NRNVNPVALP | RAQEGLRPGT | LCTVAGWGRV | ||||
SMRRGTDTLR | EVQLRVQRDR | QCLRIFGSYD | PRRQICVGDR | RERKAAFKGD | ||||
SGGPLLCNNV | AHGIVSYGKS | SGVPPEVFTR | VSSFLPWIRT | TMRSFKLLDQ | ||||
METPL |
Кодований геном білок за функціями належить до гідролаз, протеаз, серинових протеаз, антибіотиків, .
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Avril L.E., Di Martino-Ferrer M., Pignede G., Seman M., Gauthier F. (1994). Identification of the U-937 membrane-associated proteinase interacting with the V3 loop of HIV-1 gp120 as cathepsin G. FEBS Lett. 345: 81—86. PMID 8194606 DOI:10.1016/0014-5793(94)00410-2
- Heck L.W., Rostand K.S., Hunter F.A., Bhown A. (1986). Isolation, characterization, and amino-terminal amino acid sequence analysis of human neutrophil cathepsin G from normal donors. Anal. Biochem. 158: 217—227. PMID 3799965 DOI:10.1016/0003-2697(86)90612-3
- Gaskin G., Kendal H., Coulthart A., Turner N., Pusey C.D. (1995). Use of proteinase 3 purified by reverse phase HPLC to detect autoantibodies in systemic vasculitis. J. Immunol. Methods. 180: 25—33. PMID 7897245 DOI:10.1016/0022-1759(94)00295-8
- Danelishvili L., Everman J.L., McNamara M.J., Bermudez L.E. (2011). Inhibition of the plasma-membrane-associated serine protease cathepsin G by Mycobacterium tuberculosis Rv3364c suppresses caspase-1 and pyroptosis in macrophages. Front. Microbiol. 2: 281—281. PMID 22275911 DOI:10.3389/fmicb.2011.00281
- Luedecke B., Poller W., Olek K., Bartholome K. (1993). Sequence variant of the human cathepsin G gene. Hum. Genet. 91: 83—84. PMID 8454293 DOI:10.1007/BF00230230
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:2532 (англ.) . Архів оригіналу за 23 вересня 2016. Процитовано 11 вересня 2017.
- UniProt, P08311 (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CTSG angl Cathepsin G bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 14 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 255 aminokislot a molekulyarna masa 28 837 4 CTSGNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1AU8 1CGH 1KYN 1T32IdentifikatoriSimvoliCTSG CATG CG cathepsin GZovnishni ID OMIM 116830 MGI 88563 HomoloGene 105646 GeneCards CTSGOntologiya genaMolekulyarna funkciya heparin binding GO 0070122 peptidase activity GO 0001948 GO 0016582 protein binding hydrolase activity serine type endopeptidase activity serine type peptidase activityKlitinna komponenta GO 0005578 Pozaklitinna matricya klitinna membrana secretory granule cell surface ekzosoma klitinne yadro mizhklitinnij prostir azurophil granule lumen cytoplasmic stress granule extracellular region citoplazma collagen containing extracellular matrixBiologichnij proces extracellular matrix disassembly proteoliz angiotensin maturation protein phosphorylation response to lipopolysaccharide positive regulation of immune response defense response to bacterium GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid GO 0051637 defense response to Gram positive bacterium antimicrobial humoral response neutrophil degranulation defense response to fungus neutrophil mediated killing of gram positive bacteriumDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1511 13035Ensembl ENSG00000100448 ENSMUSG00000040314UniProt P08311 P28293RefSeq mRNK NM 001911NM 007800RefSeq bilok NP 001902NP 031826Lokus UCSC Hr 14 24 57 24 58 MbHr 14 56 34 56 34 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCG GFLVREDFVLTAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQY NQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRV SMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGD SGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQ METPL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do gidrolaz proteaz serinovih proteaz antibiotikiv antimikrobnih bilkiv Literaturared The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Avril L E Di Martino Ferrer M Pignede G Seman M Gauthier F 1994 Identification of the U 937 membrane associated proteinase interacting with the V3 loop of HIV 1 gp120 as cathepsin G FEBS Lett 345 81 86 PMID 8194606 DOI 10 1016 0014 5793 94 00410 2 Heck L W Rostand K S Hunter F A Bhown A 1986 Isolation characterization and amino terminal amino acid sequence analysis of human neutrophil cathepsin G from normal donors Anal Biochem 158 217 227 PMID 3799965 DOI 10 1016 0003 2697 86 90612 3 Gaskin G Kendal H Coulthart A Turner N Pusey C D 1995 Use of proteinase 3 purified by reverse phase HPLC to detect autoantibodies in systemic vasculitis J Immunol Methods 180 25 33 PMID 7897245 DOI 10 1016 0022 1759 94 00295 8 Danelishvili L Everman J L McNamara M J Bermudez L E 2011 Inhibition of the plasma membrane associated serine protease cathepsin G by Mycobacterium tuberculosis Rv3364c suppresses caspase 1 and pyroptosis in macrophages Front Microbiol 2 281 281 PMID 22275911 DOI 10 3389 fmicb 2011 00281 Luedecke B Poller W Olek K Bartholome K 1993 Sequence variant of the human cathepsin G gene Hum Genet 91 83 84 PMID 8454293 DOI 10 1007 BF00230230Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 2532 angl Arhiv originalu za 23 veresnya 2016 Procitovano 11 veresnya 2017 UniProt P08311 angl Arhiv originalu za 8 serpnya 2017 Procitovano 11 veresnya 2017 Div takozhred Hromosoma 14 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title Katepsin G amp oldid 35054683