CSF2 (англ. Colony stimulating factor 2) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. Довжина поліпептидного ланцюга білка становить 144 амінокислот, а молекулярна маса — 16 295.
CSF2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CSF2, GMCSF, colony stimulating factor 2, CSF | ||||||||||||||||
Зовнішні ІД | OMIM: 138960 MGI: 1339752 HomoloGene: 600 GeneCards: CSF2 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 5: 132.07 – 132.08 Mb | Хр. 11: 54.14 – 54.14 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MWLQSLLLLG | TVACSISAPA | RSPSPSTQPW | EHVNAIQEAR | RLLNLSRDTA | ||||
AEMNETVEVI | SEMFDLQEPT | CLQTRLELYK | QGLRGSLTKL | KGPLTMMASH | ||||
YKQHCPPTPE | TSCATQIITF | ESFKENLKDF | LLVIPFDCWE | PVQE |
Кодований геном білок за функціями належить до цитокінів, факторів росту. Задіяний у такому біологічному процесі, як поліморфізм. Секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kaushansky K., Lopez J.A., Brown C.B. (1992). Role of carbohydrate modification in the production and secretion of human granulocyte macrophage colony-stimulating factor in genetically engineered and normal mesenchymal cells. Biochemistry. 31: 1881—1886. PMID 1737041 DOI:10.1021/bi00121a042
- Diederichs K., Boone T., Karplus P.A. (1991). Novel fold and putative receptor binding site of granulocyte-macrophage colony-stimulating factor. Science. 254: 1779—1782. PMID 1837174 DOI:10.1126/science.1837174
- Miyatake S., Otsuka T., Yokota T., Lee F., Arai K. (1985). Structure of the chromosomal gene for granulocyte-macrophage colony stimulating factor: comparison of the mouse and human genes. EMBO J. 4: 2561—2568. PMID 3876930
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 31 серпня 2017.
- (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 31 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CSF2 angl Colony stimulating factor 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 5 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 144 aminokislot a molekulyarna masa 16 295 CSF2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1CSG 2GMF 4NKQ 5C7X 5D70 5D71 5D72 4RS1IdentifikatoriSimvoliCSF2 GMCSF colony stimulating factor 2 CSFZovnishni ID OMIM 138960 MGI 1339752 HomoloGene 600 GeneCards CSF2Ontologiya genaMolekulyarna funkciya growth factor activity granulocyte macrophage colony stimulating factor receptor binding GO 0001948 GO 0016582 protein binding protein tyrosine kinase activity cytokine activityKlitinna komponenta extracellular region vnutrishnoklitinna membranna organela mizhklitinnij prostirBiologichnij proces negative regulation of cytolysis positive regulation of macrophage derived foam cell differentiation regulation of cell population proliferation MAPK cascade positive regulation of podosome assembly negative regulation of extrinsic apoptotic signaling pathway in absence of ligand positive regulation of interleukin 23 production GO 1901313 positive regulation of gene expression embryonic placenta development epithelial fluid transport regulyaciya ekspresiyi geniv dendritic cell differentiation myeloid dendritic cell differentiation macrophage activation cellular response to lipopolysaccharide GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid monocyte differentiation response to fluid shear stress response to silicon dioxide neutrophil differentiation peptidyl tyrosine phosphorylation regulation of circadian sleep wake cycle sleep histamine secretion positive regulation of tyrosine phosphorylation of STAT protein cellular response to granulocyte macrophage colony stimulating factor stimulus regulation of myeloid cell differentiation regulation of signaling receptor activity GO 0045996 negative regulation of transcription DNA templated cytokine mediated signaling pathway positive regulation of cell population proliferation macrophage differentiationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1437 12981Ensembl ENSG00000164400 ENSMUSG00000018916UniProt P04141 P01587RefSeq mRNK NM 000758NM 009969RefSeq bilok NP 000749NP 034099Lokus UCSC Hr 5 132 07 132 08 MbHr 11 54 14 54 14 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTA AEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASH YKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do citokiniv faktoriv rostu Zadiyanij u takomu biologichnomu procesi yak polimorfizm Sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kaushansky K Lopez J A Brown C B 1992 Role of carbohydrate modification in the production and secretion of human granulocyte macrophage colony stimulating factor in genetically engineered and normal mesenchymal cells Biochemistry 31 1881 1886 PMID 1737041 DOI 10 1021 bi00121a042 Diederichs K Boone T Karplus P A 1991 Novel fold and putative receptor binding site of granulocyte macrophage colony stimulating factor Science 254 1779 1782 PMID 1837174 DOI 10 1126 science 1837174 Miyatake S Otsuka T Yokota T Lee F Arai K 1985 Structure of the chromosomal gene for granulocyte macrophage colony stimulating factor comparison of the mouse and human genes EMBO J 4 2561 2568 PMID 3876930PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 31 serpnya 2017 Procitovano 31 serpnya 2017 angl Arhiv originalu za 31 serpnya 2017 Procitovano 31 serpnya 2017 Div takozhHromosoma 5 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi