CREB1 (англ. CAMP responsive element binding protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 341 амінокислот, а молекулярна маса — 36 688.
CREB1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CREB1, CREB, CREB-1, cAMP responsive element binding protein 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 123810 MGI: 88494 HomoloGene: 3223 GeneCards: CREB1 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
Angiomatoid fibrous histiocytoma | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 207.53 – 207.61 Mb | Хр. 1: 64.57 – 64.64 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MTMESGAENQ | QSGDAAVTEA | ENQQMTVQAQ | PQIATLAQVS | MPAAHATSSA | ||||
PTVTLVQLPN | GQTVQVHGVI | QAAQPSVIQS | PQVQTVQSSC | KDLKRLFSGT | ||||
QISTIAESED | SQESVDSVTD | SQKRREILSR | RPSYRKILND | LSSDAPGVPR | ||||
IEEEKSEEET | SAPAITTVTV | PTPIYQTSSG | QYIAITQGGA | IQLANNGTDG | ||||
VQGLQTLTMT | NAAATQPGTT | ILQYAQTTDG | QQILVPSNQV | VVQAASGDVQ | ||||
TYQIRTAPTS | TIAPGVVMAS | SPALPTQPAE | EAARKREVRL | MKNREAAREC | ||||
RRKKKEYVKC | LENRVAVLEN | QNKTLIEELK | ALKDLYCHKS | D |
Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, біологічні ритми, диференціація, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.
Література
- Berkowitz L.A., Gilman M.Z. (1990). Two distinct forms of active transcription factor CREB (cAMP response element binding protein). Proc. Natl. Acad. Sci. U.S.A. 87: 5258—5262. PMID 2142528 DOI:10.1073/pnas.87.14.5258
- Hoeffler J.P., Meyer T.E., Yun Y., Jameson J.L., Habener J.F. (1988). Cyclic AMP-responsive DNA-binding protein: structure based on a cloned placental cDNA. Science. 242: 1430—1433. PMID 2974179 DOI:10.1126/science.2974179
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Meyer T.E., Waeber G., Lin J., Beckmann W., Habener J.F. (1993). The promoter of the gene encoding 3',5'-cyclic adenosine monophosphate (cAMP) response element binding protein contains cAMP response elements: evidence for positive autoregulation of gene transcription. Endocrinology. 132: 770—780. PMID 8381074 DOI:10.1210/endo.132.2.8381074
- Maguire H.F., Hoeffler J.P., Siddiqui A. (1991). HBV X protein alters the DNA binding specificity of CREB and ATF-2 by protein-protein interactions. Science. 252: 842—844. PMID 1827531 DOI:10.1126/science.1827531
- Zhao L.J., Giam C.-Z. (1992). Human T-cell lymphotropic virus type I (HTLV-I) transcriptional activator, Tax, enhances CREB binding to HTLV-I 21-base-pair repeats by protein-protein interaction. Proc. Natl. Acad. Sci. U.S.A. 89: 7070—7074. PMID 1386673 DOI:10.1073/pnas.89.15.7070
Примітки
- Захворювання, генетично пов'язані з CREB1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 18 червня 2017. Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CREB1 angl CAMP responsive element binding protein 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 341 aminokislot a molekulyarna masa 36 688 CREB1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2LXTIdentifikatoriSimvoliCREB1 CREB CREB 1 cAMP responsive element binding protein 1Zovnishni ID OMIM 123810 MGI 88494 HomoloGene 3223 GeneCards CREB1Pov yazani genetichni zahvoryuvannyaAngiomatoid fibrous histiocytoma Ontologiya genaMolekulyarna funkciya GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific cAMP response element binding GO 0001104 transcription coregulator activity GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding enzyme binding GO 0001948 GO 0016582 protein binding double stranded DNA binding DNA binding sequence specific DNA binding identical protein binding transcription factor activity RNA polymerase II distal enhancer sequence specific binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific transcription factor binding Hsp70 protein binding histone acetyltransferase binding arrestin family protein bindingKlitinna komponenta mitohondriya klitinne yadro ATF4 CREB1 transcription factor complex Hromatin transcription regulator complex nukleoplazma akson mitohondrialnij matriksBiologichnij proces cellular response to nerve growth factor stimulus positive regulation of lipid biosynthetic process positive regulation of long term synaptic potentiation ritmichnij proces cellular response to insulin like growth factor stimulus transcription by RNA polymerase II response to organic substance mammary gland development protein phosphorylation type I pneumocyte differentiation cirkadnij ritm positive regulation of multicellular organism growth response to L glutamate lung saccule development lung epithelium development transforming growth factor beta receptor signaling pathway regulation of apoptotic process cellular response to transforming growth factor beta stimulus response to glucagon GO 0009373 regulation of transcription DNA templated negative regulation of transcription by competitive promoter binding response to nicotine positive regulation of osteoclast differentiation pam yat negative regulation of gene expression transcription DNA templated GO 0060469 GO 0009371 positive regulation of transcription DNA templated laktaciya positive regulation of transforming growth factor beta3 production GO 0022415 viral process positive regulation of fat cell differentiation negative regulation of neuron death diferenciaciya klitin cellular response to hepatocyte growth factor stimulus protein stabilization cellular response to platelet derived growth factor stimulus regulation of circadian rhythm secretory granule organization regulation of glial cell proliferation visual learning regulation of cell size pituitary gland development positive regulation of RNA polymerase II transcription preinitiation complex assembly response to hypoxia aksonogeneza regulation of fibroblast proliferation cellular response to growth factor stimulus GO 0010260 starinnya lyudini chemotaxis to arachidonic acid response to activity cellular response to zinc ion cellular response to fatty acid positive regulation of apoptotic process positive regulation of hormone secretion GO 0072468 signalna transdukciya GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of cardiac muscle tissue development cellular response to leukemia inhibitory factor cellular response to retinoic acidDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1385 12912Ensembl ENSG00000118260 ENSMUSG00000025958UniProt P16220 Q01147RefSeq mRNK NM 004379 NM 134442 NM 001320793 NM 001371426 NM 001371427NM 001371428NM 001037726 NM 009952 NM 133828RefSeq bilok NP 001307722 NP 004370 NP 604391 NP 001358355 NP 001358356NP 001358357NP 001032815 NP 034082 NP 598589Lokus UCSC Hr 2 207 53 207 61 MbHr 1 64 57 64 64 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSA PTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGT QISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPR IEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDG VQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQ TYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak vzayemodiya hazyayin virus transkripciya regulyaciya transkripciyi biologichni ritmi diferenciaciya polimorfizm alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaBerkowitz L A Gilman M Z 1990 Two distinct forms of active transcription factor CREB cAMP response element binding protein Proc Natl Acad Sci U S A 87 5258 5262 PMID 2142528 DOI 10 1073 pnas 87 14 5258 Hoeffler J P Meyer T E Yun Y Jameson J L Habener J F 1988 Cyclic AMP responsive DNA binding protein structure based on a cloned placental cDNA Science 242 1430 1433 PMID 2974179 DOI 10 1126 science 2974179 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Meyer T E Waeber G Lin J Beckmann W Habener J F 1993 The promoter of the gene encoding 3 5 cyclic adenosine monophosphate cAMP response element binding protein contains cAMP response elements evidence for positive autoregulation of gene transcription Endocrinology 132 770 780 PMID 8381074 DOI 10 1210 endo 132 2 8381074 Maguire H F Hoeffler J P Siddiqui A 1991 HBV X protein alters the DNA binding specificity of CREB and ATF 2 by protein protein interactions Science 252 842 844 PMID 1827531 DOI 10 1126 science 1827531 Zhao L J Giam C Z 1992 Human T cell lymphotropic virus type I HTLV I transcriptional activator Tax enhances CREB binding to HTLV I 21 base pair repeats by protein protein interaction Proc Natl Acad Sci U S A 89 7070 7074 PMID 1386673 DOI 10 1073 pnas 89 15 7070PrimitkiZahvoryuvannya genetichno pov yazani z CREB1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 18 chervnya 2017 Procitovano 28 serpnya 2017 angl Arhiv originalu za 31 serpnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi