CITED2 (англ. Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 270 амінокислот, а молекулярна маса — 28 497.
CITED2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CITED2, ASD8, MRG-1, MRG1, P35SRJ, VSD2, Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2 | ||||||||||||||||
Зовнішні ІД | OMIM: 602937 MGI: 1306784 HomoloGene: 4433 GeneCards: CITED2 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
atrial heart septal defect 8 | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 6: 139.37 – 139.37 Mb | Хр. 10: 17.6 – 17.6 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MADHMMAMNH | GRFPDGTNGL | HHHPAHRMGM | GQFPSPHHHQ | QQQPQHAFNA | ||||
LMGEHIHYGA | GNMNATSGIR | HAMGPGTVNG | GHPPSALAPA | ARFNNSQFMG | ||||
PPVASQGGSL | PASMQLQKLN | NQYFNHHPYP | HNHYMPDLHP | AAGHQMNGTN | ||||
QHFRDCNPKH | SGGSSTPGGS | GGSSTPGGSG | SSSGGGAGSS | NSGGGSGSGN | ||||
MPASVAHVPA | AMLPPNVIDT | DFIDEEVLMS | LVIEMGLDRI | KELPELWLGQ | ||||
NEFDFMTDFV | CKQQPSRVSC |
Кодований геном білок за функціями належить до репресорів, активаторів, . Задіяний у таких біологічних процесах, як відповідь на стрес, транскрипція, регуляція транскрипції, диференціація клітин, альтернативний сплайсинг. Локалізований у ядрі.
Література
- Shioda T., Fenner M.H., Isselbacher K.J. (1996). msg1, a novel melanocyte-specific gene, encodes a nuclear protein and is associated with pigmentation. Proc. Natl. Acad. Sci. U.S.A. 93: 12298—12303. PMID 8901575 DOI:10.1073/pnas.93.22.12298
- Leung M.K., Jones T., Michels C.L., Livingston D.M., Bhattacharya S. (1999). Molecular cloning and chromosomal localization of the human CITED2 gene encoding p35srj/Mrg1. Genomics. 61: 307—313. PMID 10552932 DOI:10.1006/geno.1999.5970
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Tien E.S., Davis J.W., Vanden Heuvel J.P. (2004). Identification of the CREB-binding protein/p300-interacting protein CITED2 as a peroxisome proliferator-activated receptor alpha coregulator. J. Biol. Chem. 279: 24053—24063. PMID 15051727 DOI:10.1074/jbc.M401489200
- De Guzman R.N., Martinez-Yamout M.A., Dyson H.J., Wright P.E. (2004). Interaction of the TAZ1 domain of the CREB-binding protein with the activation domain of CITED2: regulation by competition between intrinsically unstructured ligands for non-identical binding sites. J. Biol. Chem. 279: 3042—3049. PMID 14594809 DOI:10.1074/jbc.M310348200
Примітки
- Захворювання, генетично пов'язані з CITED2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1987 (англ.) . Процитовано 6 вересня 2017.
- (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 6 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CITED2 angl Cbp p300 interacting transactivator with Glu Asp rich carboxy terminal domain 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 270 aminokislot a molekulyarna masa 28 497 CITED2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1P4Q 1R8UIdentifikatoriSimvoliCITED2 ASD8 MRG 1 MRG1 P35SRJ VSD2 Cbp p300 interacting transactivator with Glu Asp rich carboxy terminal domain 2Zovnishni ID OMIM 602937 MGI 1306784 HomoloGene 4433 GeneCards CITED2Pov yazani genetichni zahvoryuvannyaatrial heart septal defect 8 Ontologiya genaMolekulyarna funkciya GO 0001105 transcription coactivator activity GO 0001106 transcription corepressor activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity chromatin binding LBD domain binding GO 0001948 GO 0016582 protein binding histone acetyltransferase binding protein domain specific bindingKlitinna komponenta citoplazma klitinne yadro nukleoplazma GO 0009327 protein containing complexBiologichnij proces nodal signaling pathway involved in determination of lateral mesoderm left right asymmetry adrenal cortex formation positive regulation of transforming growth factor beta receptor signaling pathway diferenciaciya klitin response to hypoxia GO 0009373 regulation of transcription DNA templated positive regulation of cell cell adhesion embryonic heart tube left right pattern formation ventricular septum morphogenesis outflow tract morphogenesis negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II spleen development negative regulation of gene expression transcription DNA templated response to fluid shear stress response to estrogen GO 0060469 GO 0009371 positive regulation of transcription DNA templated multicellular organism development heart development determination of left right symmetry GO 1901313 positive regulation of gene expression negative regulation of cell migration positive regulation of cell cycle regulation of animal organ formation Determinaciya stati positive regulation of peroxisome proliferator activated receptor signaling pathway liver development left right pattern formation negative regulation of transcription from RNA polymerase II promoter in response to hypoxia proliferaciya GO 0045996 negative regulation of transcription DNA templated left right axis specification positive regulation of male gonad development GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II transcription by RNA polymerase II positive regulation of nucleic acid templated transcription GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase IIDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez10370 17684Ensembl ENSG00000164442 ENSMUSG00000039910UniProt Q99967 O35740RefSeq mRNK NM 006079 NM 001168388 NM 001168389NM 010828RefSeq bilok NP 001161860 NP 001161861 NP 006070NP 034958Lokus UCSC Hr 6 139 37 139 37 MbHr 10 17 6 17 6 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNA LMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMG PPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTN QHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGN MPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQ NEFDFMTDFVCKQQPSRVSC A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv aktivatoriv Zadiyanij u takih biologichnih procesah yak vidpovid na stres transkripciya regulyaciya transkripciyi diferenciaciya klitin alternativnij splajsing Lokalizovanij u yadri LiteraturaShioda T Fenner M H Isselbacher K J 1996 msg1 a novel melanocyte specific gene encodes a nuclear protein and is associated with pigmentation Proc Natl Acad Sci U S A 93 12298 12303 PMID 8901575 DOI 10 1073 pnas 93 22 12298 Leung M K Jones T Michels C L Livingston D M Bhattacharya S 1999 Molecular cloning and chromosomal localization of the human CITED2 gene encoding p35srj Mrg1 Genomics 61 307 313 PMID 10552932 DOI 10 1006 geno 1999 5970 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Tien E S Davis J W Vanden Heuvel J P 2004 Identification of the CREB binding protein p300 interacting protein CITED2 as a peroxisome proliferator activated receptor alpha coregulator J Biol Chem 279 24053 24063 PMID 15051727 DOI 10 1074 jbc M401489200 De Guzman R N Martinez Yamout M A Dyson H J Wright P E 2004 Interaction of the TAZ1 domain of the CREB binding protein with the activation domain of CITED2 regulation by competition between intrinsically unstructured ligands for non identical binding sites J Biol Chem 279 3042 3049 PMID 14594809 DOI 10 1074 jbc M310348200PrimitkiZahvoryuvannya genetichno pov yazani z CITED2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1987 angl Procitovano 6 veresnya 2017 angl Arhiv originalu za 17 veresnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi