CHRNA7 (англ. CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми. Довжина поліпептидного ланцюга білка становить 502 амінокислот, а молекулярна маса — 56 449.
CHRNA7 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CHRNA7, CHRNA7-2, NACHRA7, cholinergic receptor nicotinic alpha 7 subunit | ||||||||||||||||
Зовнішні ІД | OMIM: 118511 MGI: 99779 HomoloGene: 593 GeneCards: CHRNA7 | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
encenicline, PNU-120596, mecamylamine, AZD0328, encenicline | |||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 15: 31.92 – 32.17 Mb | Хр. 7: 62.75 – 62.86 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MRCSPGGVWL | ALAASLLHVS | LQGEFQRKLY | KELVKNYNPL | ERPVANDSQP | ||||
LTVYFSLSLL | QIMDVDEKNQ | VLTTNIWLQM | SWTDHYLQWN | VSEYPGVKTV | ||||
RFPDGQIWKP | DILLYNSADE | RFDATFHTNV | LVNSSGHCQY | LPPGIFKSSC | ||||
YIDVRWFPFD | VQHCKLKFGS | WSYGGWSLDL | QMQEADISGY | IPNGEWDLVG | ||||
IPGKRSERFY | ECCKEPYPDV | TFTVTMRRRT | LYYGLNLLIP | CVLISALALL | ||||
VFLLPADSGE | KISLGITVLL | SLTVFMLLVA | EIMPATSDSV | PLIAQYFAST | ||||
MIIVGLSVVV | TVIVLQYHHH | DPDGGKMPKW | TRVILLNWCA | WFLRMKRPGE | ||||
DKVRPACQHK | QRRCSLASVE | MSAVAPPPAS | NGNLLYIGFR | GLDGVHCVPT | ||||
PDSGVVCGRM | ACSPTHDEHL | LHGGQPPEGD | PDLAKILEEV | RYIANRFRCQ | ||||
DESEAVCSEW | KFAACVVDRL | CLMAFSVFTI | ICTIGILMSA | PNFVEAVSKD | ||||
FA |
Кодований геном білок за функціями належить до рецепторів, іонних каналів. Задіяний у таких біологічних процесах, як транспорт іонів, транспорт, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, клітинних контактах, синапсах.
Література
- Groot Kormelink P.J., Luyten W.H.M.L. (1997). Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32. FEBS Lett. 400: 309—314. PMID 9009220 DOI:10.1016/S0014-5793(96)01383-X
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Riley B., Williamson M., Collier D., Wilkie H., Makoff A. (2002). A 3-Mb map of a large segmental duplication overlapping the alpha7-nicotinic acetylcholine receptor gene (CHRNA7) at human 15q13-q14. Genomics. 79: 197—209. PMID 11829490 DOI:10.1006/geno.2002.6694
- Peng X., Katz M., Gerzanich V., Anand R., Lindstrom J. (1994). Human alpha 7 acetylcholine receptor: cloning of the alpha 7 subunit from the SH-SY5Y cell line and determination of pharmacological properties of native receptors and functional alpha 7 homomers expressed in Xenopus oocytes. Mol. Pharmacol. 45: 546—554. PMID 8145738
Примітки
- Сполуки, які фізично взаємодіють з Cholinergic receptor nicotinic alpha 7 subunit переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1960 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 25 серпня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CHRNA7 angl CHRNA7 exons 5 10 and FAM7A exons A E fusion bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 15 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 502 aminokislot a molekulyarna masa 56 449 CHRNA7Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB5AFK 5AFJ 5AFL 2MAW 5AFN 5AFM 5AFHIdentifikatoriSimvoliCHRNA7 CHRNA7 2 NACHRA7 cholinergic receptor nicotinic alpha 7 subunitZovnishni ID OMIM 118511 MGI 99779 HomoloGene 593 GeneCards CHRNA7Reaguye na spolukuencenicline PNU 120596 mecamylamine AZD0328 encenicline Ontologiya genaMolekulyarna funkciya protein homodimerization activity acetylcholine binding acetylcholine gated cation selective channel activity amyloid beta binding acetylcholine receptor activity ion channel activity chloride channel regulator activity extracellular ligand gated ion channel activity toxic substance binding ligand gated ion channel activity transmembrane signaling receptor activity calcium channel activity GO 0001948 GO 0016582 protein bindingKlitinna komponenta integral component of membrane acetylcholine gated channel complex postsynaptic membrane membrana klitinna membrana sinaps mizhklitinni kontakti integral component of plasma membrane neuron projection plasma membrane raft postsynapseBiologichnij proces response to hypoxia kognitivnist cellular calcium ion homeostasis ion transport positive regulation of angiogenesis ion transmembrane transport positive regulation of cell population proliferation GO 0015915 transport calcium ion transport GO 0072468 signalna transdukciya synaptic transmission cholinergic pam yat negative regulation of tumor necrosis factor production response to nicotine regulation of postsynaptic membrane potential excitatory postsynaptic potential positive regulation of protein phosphorylation chemical synaptic transmission learning or memory korotkochasna pam yat regulation of membrane potential synapse organization nervous system process sensory processing positive regulation of ERK1 and ERK2 cascade calcium ion transmembrane transport acetylcholine receptor signaling pathway dendritic spine organization modulation of excitatory postsynaptic potential dendrite arborization positive regulation of long term synaptic potentiation regulation of neuron death positive regulation of amyloid beta formation negative regulation of amyloid beta formation regulation of amyloid precursor protein catabolic process response to amyloid beta response to acetylcholine regulation of amyloid fibril formation positive regulation of CoA transferase activity positive regulation of excitatory postsynaptic potentialDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez1139 11441Ensembl ENSG00000274542 ENSG00000175344 ENSG00000282088 ENSMUSG00000030525UniProt P36544 P49582RefSeq mRNK NM 000746 NM 001190455NM 007390RefSeq bilok NP 000737 NP 001177384NP 031416Lokus UCSC Hr 15 31 92 32 17 MbHr 7 62 75 62 86 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQP LTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTV RFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC YIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVG IPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALL VFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGE DKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPT PDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQ DESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKD FA A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv ionnih kanaliv Zadiyanij u takih biologichnih procesah yak transport ioniv transport alternativnij splajsing Lokalizovanij u klitinnij membrani membrani klitinnih kontaktah sinapsah LiteraturaGroot Kormelink P J Luyten W H M L 1997 Cloning and sequence of full length cDNAs encoding the human neuronal nicotinic acetylcholine receptor nAChR subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH SY5Y and or IMR 32 FEBS Lett 400 309 314 PMID 9009220 DOI 10 1016 S0014 5793 96 01383 X The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Riley B Williamson M Collier D Wilkie H Makoff A 2002 A 3 Mb map of a large segmental duplication overlapping the alpha7 nicotinic acetylcholine receptor gene CHRNA7 at human 15q13 q14 Genomics 79 197 209 PMID 11829490 DOI 10 1006 geno 2002 6694 Peng X Katz M Gerzanich V Anand R Lindstrom J 1994 Human alpha 7 acetylcholine receptor cloning of the alpha 7 subunit from the SH SY5Y cell line and determination of pharmacological properties of native receptors and functional alpha 7 homomers expressed in Xenopus oocytes Mol Pharmacol 45 546 554 PMID 8145738PrimitkiSpoluki yaki fizichno vzayemodiyut z Cholinergic receptor nicotinic alpha 7 subunit pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1960 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 25 serpnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 15 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi