CDK4 (англ. Cyclin dependent kinase 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 303 амінокислот, а молекулярна маса — 33 730.
CDK4 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CDK4, CMM3, PSK-J3, cyclin-dependent kinase 4, cyclin dependent kinase 4 | ||||||||||||||||
Зовнішні ІД | OMIM: 123829 MGI: 88357 HomoloGene: 55429 GeneCards: CDK4 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
melanoma, cutaneous malignant, susceptibility to, 3, mucosal melanoma | |||||||||||||||||
Реагує на сполуку | |||||||||||||||||
alvocidib, palbociclib | |||||||||||||||||
trilaciclib | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 57.75 – 57.76 Mb | н/д | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MATSRYEPVA | EIGVGAYGTV | YKARDPHSGH | FVALKSVRVP | NGGGGGGGLP | ||||
ISTVREVALL | RRLEAFEHPN | VVRLMDVCAT | SRTDREIKVT | LVFEHVDQDL | ||||
RTYLDKAPPP | GLPAETIKDL | MRQFLRGLDF | LHANCIVHRD | LKPENILVTS | ||||
GGTVKLADFG | LARIYSYQMA | LTPVVVTLWY | RAPEVLLQST | YATPVDMWSV | ||||
GCIFAEMFRR | KPLFCGNSEA | DQLGKIFDLI | GLPPEDDWPR | DVSLPRGAFP | ||||
PRGPRPVQSV | VPEMEESGAQ | LLLEMLTFNP | HKRISAFRAL | QHSYLHKDEG | ||||
NPE |
Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, поділ клітини, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, ядрі, мембрані.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Hanks S.K. (1987). Homology probing: identification of cDNA clones encoding members of the protein-serine kinase family. Proc. Natl. Acad. Sci. U.S.A. 84: 388—392. PMID 2948189 DOI:10.1073/pnas.84.2.388
- Wang G.L., Iakova P., Wilde M., Awad S., Timchenko N.A. (2004). Liver tumors escape negative control of proliferation via PI3K/Akt-mediated block of C/EBP alpha growth inhibitory activity. Genes Dev. 18: 912—925. PMID 15107404 DOI:10.1101/gad.1183304
- Zhang T., Liu W.D., Saunee N.A., Breslin M.B., Lan M.S. (2009). Zinc finger transcription factor INSM1 interrupts cyclin D1 and CDK4 binding and induces cell cycle arrest. J. Biol. Chem. 284: 5574—5581. PMID 19124461 DOI:10.1074/jbc.M808843200
- Ray A., James M.K., Larochelle S., Fisher R.P., Blain S.W. (2009). p27Kip1 inhibits cyclin D-cyclin-dependent kinase 4 by two independent modes. Mol. Cell. Biol. 29: 986—999. PMID 19075005 DOI:10.1128/MCB.00898-08
- Bockstaele L., Bisteau X., Paternot S., Roger P.P. (2009). Differential regulation of cyclin-dependent kinase 4 (CDK4) and CDK6, evidence that CDK4 might not be activated by CDK7, and design of a CDK6 activating mutation. Mol. Cell. Biol. 29: 4188—4200. PMID 19487459 DOI:10.1128/MCB.01823-08
Примітки
- Захворювання, генетично пов'язані з CDK4 переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з Cyclin dependent kinase 4 переглянути/редагувати посилання на ВікіДаних.
- Сполуки, які фізично взаємодіють з Cyclin-dependent kinase 4 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1773 (англ.) . Процитовано 11 вересня 2017.
- UniProt, P11802 (англ.) . Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CDK4 angl Cyclin dependent kinase 4 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 303 aminokislot a molekulyarna masa 33 730 CDK4Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2W96 2W99 2W9F 2W9Z 3G33 5FWL 5FWM 5FWKIdentifikatoriSimvoliCDK4 CMM3 PSK J3 cyclin dependent kinase 4 cyclin dependent kinase 4Zovnishni ID OMIM 123829 MGI 88357 HomoloGene 55429 GeneCards CDK4Pov yazani genetichni zahvoryuvannyamelanoma cutaneous malignant susceptibility to 3 mucosal melanoma Reaguye na spolukualvocidib palbociclib trilaciclib Ontologiya genaMolekulyarna funkciya transferase activity nucleotide binding protein kinase activity kinase activity protein serine threonine kinase activity cyclin dependent protein serine threonine kinase regulator activity GO 0001948 GO 0016582 protein binding ATP binding cyclin binding cyclin dependent protein serine threonine kinase activity GO 0032403 protein containing complex bindingKlitinna komponenta citoplazma gialoplazma cyclin dependent protein kinase holoenzyme complex yaderna membrana membrana transcription regulator complex bicellular tight junction nukleoplazma yaderce perinuclear region of cytoplasm Hromatin klitinne yadro cyclin D2 CDK4 complex GO 0009327 protein containing complexBiologichnij proces fosforilyuvannya response to testosterone positive regulation of fibroblast proliferation response to hyperoxia positive regulation of translation regulation of cell cycle podil klitini protein phosphorylation lens development in camera type eye regulation of cell population proliferation response to lead ion cirkadnij ritm animal organ regeneration positive regulation of cell population proliferation positive regulation of cell size positive regulation of apoptotic process regulyaciya ekspresiyi geniv klitinnij cikl positive regulation of G2 M transition of mitotic cell cycle response to toxic substance positive regulation of cell cycle GO 0072468 signalna transdukciya multicellular organism development response to organic substance cellular response to insulin stimulus regulation of multicellular organism growth GO 1903104 regulation of insulin receptor signaling pathway regulation of lipid biosynthetic process regulation of lipid catabolic process adipose tissue development cellular response to lipopolysaccharide cellular response to interleukin 4 cellular response to phorbol 13 acetate 12 myristate cellular response to ionomycin transcription initiation from RNA polymerase II promoter G1 S transition of mitotic cell cycle regulation of cyclin dependent protein serine threonine kinase activity GO 1990376 negative regulation of G1 S transition of mitotic cell cycleDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1019 12567Ensembl ENSG00000135446 n dUniProt P11802 P30285RefSeq mRNK NM 052984 NM 000075NM 009870 NM 001355005RefSeq bilok NP 000066NP 034000 NP 001341934Lokus UCSC Hr 12 57 75 57 76 Mbn dPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLP ISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDL RTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTS GGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSV GCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFP PRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG NPE A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz serin treoninovih proteyinkinaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl podil klitini acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami Lokalizovanij u citoplazmi yadri membrani LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Hanks S K 1987 Homology probing identification of cDNA clones encoding members of the protein serine kinase family Proc Natl Acad Sci U S A 84 388 392 PMID 2948189 DOI 10 1073 pnas 84 2 388 Wang G L Iakova P Wilde M Awad S Timchenko N A 2004 Liver tumors escape negative control of proliferation via PI3K Akt mediated block of C EBP alpha growth inhibitory activity Genes Dev 18 912 925 PMID 15107404 DOI 10 1101 gad 1183304 Zhang T Liu W D Saunee N A Breslin M B Lan M S 2009 Zinc finger transcription factor INSM1 interrupts cyclin D1 and CDK4 binding and induces cell cycle arrest J Biol Chem 284 5574 5581 PMID 19124461 DOI 10 1074 jbc M808843200 Ray A James M K Larochelle S Fisher R P Blain S W 2009 p27Kip1 inhibits cyclin D cyclin dependent kinase 4 by two independent modes Mol Cell Biol 29 986 999 PMID 19075005 DOI 10 1128 MCB 00898 08 Bockstaele L Bisteau X Paternot S Roger P P 2009 Differential regulation of cyclin dependent kinase 4 CDK4 and CDK6 evidence that CDK4 might not be activated by CDK7 and design of a CDK6 activating mutation Mol Cell Biol 29 4188 4200 PMID 19487459 DOI 10 1128 MCB 01823 08PrimitkiZahvoryuvannya genetichno pov yazani z CDK4 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Cyclin dependent kinase 4 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Cyclin dependent kinase 4 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1773 angl Procitovano 11 veresnya 2017 UniProt P11802 angl Procitovano 11 veresnya 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi