CD63 (англ. CD63 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 238 амінокислот, а молекулярна маса — 25 637.
CD63 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | CD63, LAMP-3, ME491, MLA1, OMA81H, TSPAN30, CD63 molecule | ||||||||||||||||
Зовнішні ІД | OMIM: 155740 MGI: 99529 HomoloGene: 37526 GeneCards: CD63 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 55.73 – 55.73 Mb | Хр. 10: 128.74 – 128.75 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MAVEGGMKCV | KFLLYVLLLA | FCACAVGLIA | VGVGAQLVLS | QTIIQGATPG | ||||
SLLPVVIIAV | GVFLFLVAFV | GCCGACKENY | CLMITFAIFL | SLIMLVEVAA | ||||
AIAGYVFRDK | VMSEFNNNFR | QQMENYPKNN | HTASILDRMQ | ADFKCCGAAN | ||||
YTDWEKIPSM | SKNRVPDSCC | INVTVGCGIN | FNEKAIHKEG | CVEKIGGWLR | ||||
KNVLVVAAAA | LGIAFVEVLG | IVFACCLVKS | IRSGYEVM |
Задіяний у таких біологічних процесах, як транспорт, транспорт білків, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані, лізосомі, ендосомах. Також секретований назовні.
Література
- Wang M.X., Earley J.J. Jr., Shields J.A., Donoso L.A. (1992). An ocular melanoma-associated antigen. Molecular characterization. Arch. Ophthalmol. 110: 399—404. PMID 1339263 DOI:10.1001/archopht.1992.01080150097036
- Hotta H., Miyamoto H., Hara I., Takahashi N., Homma M. (1992). Genomic structure of the ME491/CD63 antigen gene and functional analysis of the 5'-flanking regulatory sequences. Biochem. Biophys. Res. Commun. 185: 436—442. PMID 1599482 DOI:10.1016/S0006-291X(05)81004-6
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zhang H., Li X.-J., Martin D.B., Aebersold R. (2003). Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat. Biotechnol. 21: 660—666. PMID 12754519 DOI:10.1038/nbt827
- Jung K.K., Liu X.W., Chirco R., Fridman R., Kim H.R. (2006). Identification of CD63 as a tissue inhibitor of metalloproteinase-1 interacting cell surface protein. EMBO J. 25: 3934—3942. PMID 16917503 DOI:10.1038/sj.emboj.7601281
- Israels S.J., McMillan-Ward E.M. (2010). Palmitoylation supports the association of tetraspanin CD63 with CD9 and integrin alphaIIbbeta3 in activated platelets. Thromb. Res. 125: 152—158. PMID 19640571 DOI:10.1016/j.thromres.2009.07.005
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1692 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 24 вересня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CD63 angl CD63 molecule bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 238 aminokislot a molekulyarna masa 25 637 CD63IdentifikatoriSimvoliCD63 LAMP 3 ME491 MLA1 OMA81H TSPAN30 CD63 moleculeZovnishni ID OMIM 155740 MGI 99529 HomoloGene 37526 GeneCards CD63Ontologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein bindingKlitinna komponenta integral component of membrane multivesicular body endosoma multivesicular body membrane membrana late endosome membrane intrinsic component of plasma membrane Melanosoma klitinna membrana integral component of plasma membrane endosome lumen multivesicular body internal vesicle lysosomal membrane extracellular region platelet dense granule membrane lizosoma endosome membrane ekzosoma mizhklitinnij prostir cell surface azurophil granule membrane late endosomeBiologichnij proces positive regulation of receptor internalization platelet degranulation pigment granule maturation endosome to melanosome transport protein transport positive regulation of integrin mediated signaling pathway cell matrix adhesion cell migration neutrophil degranulation GO 0015915 transport pigmentation pigment cell differentiation regulation of vascular endothelial growth factor signaling pathway cell surface receptor signaling pathway positive regulation of endocytosis regulation of potassium ion transmembrane transportDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez967 12512Ensembl ENSG00000135404 ENSMUSG00000025351UniProt P08962 P41731RefSeq mRNK NM 001780 NM 001040034 NM 001257389 NM 001257390 NM 001257391NM 001257392 NM 001257400 NM 001257401 NM 001267698NM 001042580 NM 001282966 NM 007653RefSeq bilok NP 001244318 NP 001244319 NP 001244320 NP 001244321 NP 001244329NP 001244330 NP 001254627 NP 001771NP 001036045 NP 001269895 NP 031679Lokus UCSC Hr 12 55 73 55 73 MbHr 10 128 74 128 75 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVMA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak transport transport bilkiv alternativnij splajsing Lokalizovanij u klitinnij membrani membrani lizosomi endosomah Takozh sekretovanij nazovni LiteraturaWang M X Earley J J Jr Shields J A Donoso L A 1992 An ocular melanoma associated antigen Molecular characterization Arch Ophthalmol 110 399 404 PMID 1339263 DOI 10 1001 archopht 1992 01080150097036 Hotta H Miyamoto H Hara I Takahashi N Homma M 1992 Genomic structure of the ME491 CD63 antigen gene and functional analysis of the 5 flanking regulatory sequences Biochem Biophys Res Commun 185 436 442 PMID 1599482 DOI 10 1016 S0006 291X 05 81004 6 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang H Li X J Martin D B Aebersold R 2003 Identification and quantification of N linked glycoproteins using hydrazide chemistry stable isotope labeling and mass spectrometry Nat Biotechnol 21 660 666 PMID 12754519 DOI 10 1038 nbt827 Jung K K Liu X W Chirco R Fridman R Kim H R 2006 Identification of CD63 as a tissue inhibitor of metalloproteinase 1 interacting cell surface protein EMBO J 25 3934 3942 PMID 16917503 DOI 10 1038 sj emboj 7601281 Israels S J McMillan Ward E M 2010 Palmitoylation supports the association of tetraspanin CD63 with CD9 and integrin alphaIIbbeta3 in activated platelets Thromb Res 125 152 158 PMID 19640571 DOI 10 1016 j thromres 2009 07 005PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1692 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 24 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi