CD40 (англ. CD40 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 277 амінокислот, а молекулярна маса — 30 619.
CD40 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CD40, Bp50, CDW40, TNFRSF5, p50, CD40 (protein), CD40 molecule | ||||||||||||||||
Зовнішні ІД | OMIM: 109535 MGI: 88336 HomoloGene: 954 GeneCards: CD40 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
ревматоїдний артрит, CD40 deficiency | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 20: 46.12 – 46.13 Mb | Хр. 2: 164.9 – 164.91 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MVRLPLQCVL | WGCLLTAVHP | EPPTACREKQ | YLINSQCCSL | CQPGQKLVSD | ||||
CTEFTETECL | PCGESEFLDT | WNRETHCHQH | KYCDPNLGLR | VQQKGTSETD | ||||
TICTCEEGWH | CTSEACESCV | LHRSCSPGFG | VKQIATGVSD | TICEPCPVGF | ||||
FSNVSSAFEK | CHPWTSCETK | DLVVQQAGTN | KTDVVCGPQD | RLRALVVIPI | ||||
IFGILFAILL | VLVFIKKVAK | KPTNKAPHPK | QEPQEINFPD | DLPGSNTAAP | ||||
VQETLHGCQP | VTQEDGKESR | ISVQERQ |
Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як імунітет, альтернативний сплайсинг. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.
Література
- Tone M., Tone Y., Fairchild P.J., Wykes M., Waldmann H. (2001). Regulation of CD40 function by its isoforms generated through alternative splicing. Proc. Natl. Acad. Sci. U.S.A. 98: 1751—1756. PMID 11172023 DOI:10.1073/pnas.98.4.1751
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504
- Sato T., Irie S., Reed J.C. (1995). A novel member of the TRAF family of putative signal transducing proteins binds to the cytosolic domain of CD40. FEBS Lett. 358: 113—118. PMID 7530216 DOI:10.1016/0014-5793(94)01406-Q
- Bajorath J., Aruffo A. (1997). Construction and analysis of a detailed three-dimensional model of the ligand binding domain of the human B cell receptor CD40. Proteins. 27: 59—70. PMID 9037712 DOI:10.1002/(SICI)1097-0134(199701)27:1<59::AID-PROT7>3.3.CO;2-Z
- Stamenkovic I., Clark E.A., Seed B. (1989). A B-lymphocyte activation molecule related to the nerve growth factor receptor and induced by cytokines in carcinomas. EMBO J. 8: 1403—1410. PMID 2475341
Примітки
- Захворювання, генетично пов'язані з CD40 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:11919 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CD40 angl CD40 molecule bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 277 aminokislot a molekulyarna masa 30 619 CD40Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1CZZ 1D00 1FLL 1LB6 3QD6 5DMJ 5IHL 5DMIIdentifikatoriSimvoliCD40 Bp50 CDW40 TNFRSF5 p50 CD40 protein CD40 moleculeZovnishni ID OMIM 109535 MGI 88336 HomoloGene 954 GeneCards CD40Pov yazani genetichni zahvoryuvannyarevmatoyidnij artrit CD40 deficiency Ontologiya genaMolekulyarna funkciya GO 0003823 GO 0051635 antigen binding signal transducer activity GO 0001948 GO 0016582 protein binding tumor necrosis factor activated receptor activity enzyme binding ubiquitin protein ligase binding protein domain specific binding signaling receptor activityKlitinna komponenta citoplazma integral component of membrane vnutrishnoklitinna membranna organela membrana klitinna membrana integral component of plasma membrane extracellular region cell surface CD40 receptor complex ekzosoma external side of plasma membrane mizhklitinnij prostir neuronal cell body varicosityBiologichnij proces positive regulation of protein phosphorylation positive regulation of MAP kinase activity positive regulation of interleukin 12 production protein kinase B signaling positive regulation of protein kinase C signaling proces imunnoyi sistemi cellular calcium ion homeostasis tumor necrosis factor mediated signaling pathway immune response regulating cell surface receptor signaling pathway platelet activation multicellular organism development B cell activation GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity response to lipopolysaccharide B cell proliferation cellular response to mechanical stimulus positive regulation of endothelial cell apoptotic process regulation of cell population proliferation positive regulation of B cell proliferation positive regulation of NF kappaB transcription factor activity defense response to virus GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid regulation of immune response positive regulation of I kappaB kinase NF kappaB signaling apoptotic signaling pathway positive regulation of isotype switching to IgG isotypes cellular response to lipopolysaccharide GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II defense response to protozoan response to bacterium response to nutrient levels response to cobalamin response to interferon gamma cellular response to erythropoietin cellular response to interleukin 1 cellular response to tumor necrosis factor response to peptide inflammatory response positive regulation of tyrosine phosphorylation of STAT protein positive regulation of blood vessel endothelial cell migration positive regulation of angiogenesis GO 0034622 protein containing complex assemblyDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez958 21939Ensembl ENSG00000101017 ENSMUSG00000017652UniProt P25942 P27512RefSeq mRNK NM 001250 NM 001302753 NM 152854 NM 001322421 NM 001322422NM 001362758NM 011611 NM 170702 NM 170703 NM 170704RefSeq bilok NP 001241 NP 001289682 NP 001309350 NP 001309351 NP 690593NP 001349687NP 035741 NP 733803 NP 733804 NP 733805Lokus UCSC Hr 20 46 12 46 13 MbHr 2 164 9 164 91 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSD CTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETD TICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGF FSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPI IFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAP VQETLHGCQPVTQEDGKESRISVQERQ A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do receptoriv Zadiyanij u takih biologichnih procesah yak imunitet alternativnij splajsing Lokalizovanij u klitinnij membrani membrani Takozh sekretovanij nazovni LiteraturaTone M Tone Y Fairchild P J Wykes M Waldmann H 2001 Regulation of CD40 function by its isoforms generated through alternative splicing Proc Natl Acad Sci U S A 98 1751 1756 PMID 11172023 DOI 10 1073 pnas 98 4 1751 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504 Sato T Irie S Reed J C 1995 A novel member of the TRAF family of putative signal transducing proteins binds to the cytosolic domain of CD40 FEBS Lett 358 113 118 PMID 7530216 DOI 10 1016 0014 5793 94 01406 Q Bajorath J Aruffo A 1997 Construction and analysis of a detailed three dimensional model of the ligand binding domain of the human B cell receptor CD40 Proteins 27 59 70 PMID 9037712 DOI 10 1002 SICI 1097 0134 199701 27 1 lt 59 AID PROT7 gt 3 3 CO 2 Z Stamenkovic I Clark E A Seed B 1989 A B lymphocyte activation molecule related to the nerve growth factor receptor and induced by cytokines in carcinomas EMBO J 8 1403 1410 PMID 2475341PrimitkiZahvoryuvannya genetichno pov yazani z CD40 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 11919 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 23 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 20 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi