Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
CD28 (англ. CD28 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 220 амінокислот, а молекулярна маса — 25 066.
| CD28 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | CD28, Tp44, CD28 molecule | ||||||||||||||||
| Зовнішні ІД | OMIM: 186760 MGI: 88327 HomoloGene: 4473 GeneCards: CD28 | ||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
   | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 2: 203.71 – 203.74 Mb | Хр. 1: 60.76 – 60.81 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MLRLLLALNL | FPSIQVTGNK | ILVKQSPMLV | AYDNAVNLSC | KYSYNLFSRE | ||||
| FRASLHKGLD | SAVEVCVVYG | NYSQQLQVYS | KTGFNCDGKL | GNESVTFYLQ | ||||
| NLYVNQTDIY | FCKIEVMYPP | PYLDNEKSNG | TIIHVKGKHL | CPSPLFPGPS | ||||
| KPFWVLVVVG | GVLACYSLLV | TVAFIIFWVR | SKRSRLLHSD | YMNMTPRRPG | ||||
| PTRKHYQPYA | PPRDFAAYRS |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі як альтернативний сплайсинг. Локалізований у мембрані.
Література
- Aruffo A., Seed B. (1987). Molecular cloning of a CD28 cDNA by a high-efficiency COS cell expression system. Proc. Natl. Acad. Sci. U.S.A. 84: 8573—8577. PMID 2825196 DOI:10.1073/pnas.84.23.8573
- Deshpande M., Venuprasad K., Parab P.B., Saha B., Mitra D. (2002). A novel CD28 mRNA variant and simultaneous presence of various CD28 mRNA isoforms in human T lymphocytes. Hum. Immunol. 63: 20—23. PMID 11916166 DOI:10.1016/S0198-8859(01)00354-8
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Blotta M.H., Marshall J.D., DeKruyff R.H., Umetsu D.T. (1996). Cross-linking of the CD40 ligand on human CD4+ T lymphocytes generates a costimulatory signal that up-regulates IL-4 synthesis. J. Immunol. 156: 3133—3140. PMID 8617933
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1653 (англ.) . Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 28 серпня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CD28 angl CD28 molecule bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 220 aminokislot a molekulyarna masa 25 066 CD28Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1YJD 3WA4 5AULIdentifikatoriSimvoliCD28 Tp44 CD28 moleculeZovnishni ID OMIM 186760 MGI 88327 HomoloGene 4473 GeneCards CD28Ontologiya genaMolekulyarna funkciya coreceptor activity protease binding GO 0001948 GO 0016582 protein binding identical protein binding protein kinase binding phosphatidylinositol 4 5 bisphosphate 3 kinase activityKlitinna komponenta integral component of membrane gialoplazma membrana klitinna membrana integral component of plasma membrane immunological synapse external side of plasma membrane cell surface protein complex involved in cell adhesionBiologichnij proces regulatory T cell differentiation regulation of regulatory T cell differentiation T cell costimulation GO 0019049 GO 0030683 mitigation of host defenses by virus positive regulation of translation negative regulation of gene expression negative thymic T cell selection cell surface receptor signaling pathway GO 1901313 positive regulation of gene expression humoral immune response positive regulation of T cell proliferation positive regulation of alpha beta T cell proliferation GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid apoptotic signaling pathway positive regulation of phosphatidylinositol 3 kinase signaling positive regulation of isotype switching to IgG isotypes positive regulation of viral genome replication T cell receptor signaling pathway positive regulation of mitotic nuclear division positive regulation of inflammatory response to antigenic stimulus GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of interleukin 10 production phosphatidylinositol phosphate biosynthetic process positive regulation of interleukin 4 production positive regulation of protein kinase B signaling T cell activation negative regulation of apoptotic process regulation of T cell proliferation proces imunnoyi sistemiDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez940 12487Ensembl ENSG00000178562 ENSMUSG00000026012UniProt P10747 P31041RefSeq mRNK NM 001243077 NM 001243078 NM 006139NM 007642RefSeq bilok NP 001230006 NP 001230007 NP 006130NP 031668Lokus UCSC Hr 2 203 71 203 74 MbHr 1 60 76 60 81 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSRE FRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQ NLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPS KPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPG PTRKHYQPYAPPRDFAAYRS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Lokalizovanij u membrani LiteraturaAruffo A Seed B 1987 Molecular cloning of a CD28 cDNA by a high efficiency COS cell expression system Proc Natl Acad Sci U S A 84 8573 8577 PMID 2825196 DOI 10 1073 pnas 84 23 8573 Deshpande M Venuprasad K Parab P B Saha B Mitra D 2002 A novel CD28 mRNA variant and simultaneous presence of various CD28 mRNA isoforms in human T lymphocytes Hum Immunol 63 20 23 PMID 11916166 DOI 10 1016 S0198 8859 01 00354 8 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Blotta M H Marshall J D DeKruyff R H Umetsu D T 1996 Cross linking of the CD40 ligand on human CD4 T lymphocytes generates a costimulatory signal that up regulates IL 4 synthesis J Immunol 156 3133 3140 PMID 8617933PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1653 angl Procitovano 28 serpnya 2017 angl Arhiv originalu za 31 serpnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi