BIRC2 (англ. Baculoviral IAP repeat containing 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 618 амінокислот, а молекулярна маса — 69 900.
BIRC2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | BIRC2, API1, HIAP2, Hiap-2, MIHB, RNF48, c-IAP1, cIAP1, baculoviral IAP repeat containing 2 | ||||||||||||||||
Зовнішні ІД | OMIM: 601712 MGI: 1197009 HomoloGene: 900 GeneCards: BIRC2 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 102.35 – 102.38 Mb | Хр. 9: 7.82 – 7.84 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MHKTASQRLF | PGPSYQNIKS | IMEDSTILSD | WTNSNKQKMK | YDFSCELYRM | ||||
STYSTFPAGV | PVSERSLARA | GFYYTGVNDK | VKCFCCGLML | DNWKLGDSPI | ||||
QKHKQLYPSC | SFIQNLVSAS | LGSTSKNTSP | MRNSFAHSLS | PTLEHSSLFS | ||||
GSYSSLSPNP | LNSRAVEDIS | SSRTNPYSYA | MSTEEARFLT | YHMWPLTFLS | ||||
PSELARAGFY | YIGPGDRVAC | FACGGKLSNW | EPKDDAMSEH | RRHFPNCPFL | ||||
ENSLETLRFS | ISNLSMQTHA | ARMRTFMYWP | SSVPVQPEQL | ASAGFYYVGR | ||||
NDDVKCFCCD | GGLRCWESGD | DPWVEHAKWF | PRCEFLIRMK | GQEFVDEIQG | ||||
RYPHLLEQLL | STSDTTGEEN | ADPPIIHFGP | GESSSEDAVM | MNTPVVKSAL | ||||
EMGFNRDLVK | QTVQSKILTT | GENYKTVNDI | VSALLNAEDE | KREEEKEKQA | ||||
EEMASDDLSL | IRKNRMALFQ | QLTCVLPILD | NLLKANVINK | QEHDIIKQKT | ||||
QIPLQARELI | DTILVKGNAA | ANIFKNCLKE | IDSTLYKNLF | VDKNMKYIPT | ||||
EDVSGLSLEE | QLRRLQEERT | CKVCMDKEVS | VVFIPCGHLV | VCQECAPSLR | ||||
KCPICRGIIK | GTVRTFLS |
Кодований геном білок за функціями належить до трансфераз, активаторів. Задіяний у таких біологічних процесах, як апоптоз, транскрипція, регуляція транскрипції, убіквітинування білків, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, ядрі.
Література
- Rothe M., Pan M.-G., Henzel W.J., Ayres T.M., Goeddel D.V. (1995). The TNFR2-TRAF signaling complex contains two novel proteins related to baculoviral inhibitor of apoptosis proteins. Cell. 83: 1243—1252. PMID 8548810 DOI:10.1016/0092-8674(95)90149-3
- Uren A.G., Pakusch M., Hawkins C.J., Puls K.L., Vaux D.L. (1996). Cloning and expression of apoptosis inhibitory protein homologs that function to inhibit apoptosis and/or bind tumor necrosis factor receptor-associated factors. Proc. Natl. Acad. Sci. U.S.A. 93: 4974—4978. PMID 8643514 DOI:10.1073/pnas.93.10.4974
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Dubrez-Daloz L., Dupoux A., Cartier J. (2008). IAPs: more than just inhibitors of apoptosis proteins. Cell Cycle. 7: 1036—1046. PMID 18414036 DOI:10.4161/cc.7.8.5783
- Lopez J., Meier P. (2010). To fight or die - inhibitor of apoptosis proteins at the crossroad of innate immunity and death. Curr. Opin. Cell Biol. 22: 872—881. PMID 20888210 DOI:10.1016/j.ceb.2010.08.025
- Gyrd-Hansen M., Meier P. (2010). IAPs: from caspase inhibitors to modulators of NF-kappaB, inflammation and cancer. Nat. Rev. Cancer. 10: 561—574. PMID 20651737 DOI:10.1038/nrc2889
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 15 вересня 2015. Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 14 вересня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BIRC2 angl Baculoviral IAP repeat containing 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 618 aminokislot a molekulyarna masa 69 900 BIRC2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1QBH 2L9M 3D9T 3D9U 3M1D 3MUP 3OZ1 3T6P 3UW4 4EB9 4HY4 4HY5 4KMN 4LGE 4LGU 4MTI 4MU7IdentifikatoriSimvoliBIRC2 API1 HIAP2 Hiap 2 MIHB RNF48 c IAP1 cIAP1 baculoviral IAP repeat containing 2Zovnishni ID OMIM 601712 MGI 1197009 HomoloGene 900 GeneCards BIRC2Ontologiya genaMolekulyarna funkciya protein N terminus binding zv yazuvannya z ionom metalu cysteine type endopeptidase inhibitor activity involved in apoptotic process GO 0001948 GO 0016582 protein binding transferase activity ubiquitin binding chaperone binding FBXO family protein binding zinc ion binding GO 0001105 transcription coactivator activity GO 0050372 ubiquitin protein transferase activity identical protein binding GO 1904264 GO 1904822 GO 0090622 GO 0090302 ubiquitin protein ligase activityKlitinna komponenta gialoplazma XY body membrane raft CD40 receptor complex cytoplasmic side of plasma membrane klitinne yadro citoplazma GO 0009327 protein containing complexBiologichnij proces regulation of apoptotic process regulation of nucleotide binding oligomerization domain containing signaling pathway positive regulation of protein K63 linked ubiquitination response to hypoxia GO 0009373 regulation of transcription DNA templated regulation of innate immune response GO 1904578 response to organic cyclic compound negative regulation of ripoptosome assembly involved in necroptotic process inhibition of cysteine type endopeptidase activity involved in apoptotic process placenta development regulation of cysteine type endopeptidase activity regulation of RIG I signaling pathway regulation of tumor necrosis factor mediated signaling pathway tumor necrosis factor mediated signaling pathway GO 1904489 regulation of reactive oxygen species metabolic process transcription DNA templated positive regulation of protein monoubiquitination mitotic spindle assembly cell surface receptor signaling pathway NIK NF kappaB signaling regulation of cell population proliferation response to organonitrogen compound positive regulation of protein K48 linked ubiquitination response to cAMP response to ethanol I kappaB kinase NF kappaB signaling proteasome mediated ubiquitin dependent protein catabolic process GO 0060554 GO 0060555 Nekroptoz GO 0097285 apoptoz protein deubiquitination cellular response to tumor necrosis factor regulation of NIK NF kappaB signaling positive regulation of protein polyubiquitination negative regulation of necroptotic process protein polyubiquitination regulation of toll like receptor signaling pathway negative regulation of apoptotic process positive regulation of I kappaB kinase NF kappaB signaling regulyaciya diferenciyuvannya klitin regulation of inflammatory response regulation of cell cycle regulation of necroptotic process protein heterooligomerization positive regulation of nucleic acid templated transcription MyD88 independent toll like receptor signaling pathway TRIF dependent toll like receptor signaling pathway positive regulation of protein ubiquitination negative regulation of cysteine type endopeptidase activity involved in apoptotic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez329 11797Ensembl ENSG00000110330 ENSMUSG00000057367UniProt Q13490 Q62210RefSeq mRNK NM 001256166 NM 001166 NM 001256163NM 007465 NM 001291503RefSeq bilok NP 001157 NP 001243092 NP 001243095NP 001278432 NP 031491Lokus UCSC Hr 11 102 35 102 38 MbHr 9 7 82 7 84 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRM STYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPI QKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFS GSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLS PSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFL ENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQG RYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSAL EMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQA EEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKT QIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPT EDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR KCPICRGIIKGTVRTFLS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz aktivatoriv Zadiyanij u takih biologichnih procesah yak apoptoz transkripciya regulyaciya transkripciyi ubikvitinuvannya bilkiv alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku Lokalizovanij u citoplazmi yadri LiteraturaRothe M Pan M G Henzel W J Ayres T M Goeddel D V 1995 The TNFR2 TRAF signaling complex contains two novel proteins related to baculoviral inhibitor of apoptosis proteins Cell 83 1243 1252 PMID 8548810 DOI 10 1016 0092 8674 95 90149 3 Uren A G Pakusch M Hawkins C J Puls K L Vaux D L 1996 Cloning and expression of apoptosis inhibitory protein homologs that function to inhibit apoptosis and or bind tumor necrosis factor receptor associated factors Proc Natl Acad Sci U S A 93 4974 4978 PMID 8643514 DOI 10 1073 pnas 93 10 4974 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Dubrez Daloz L Dupoux A Cartier J 2008 IAPs more than just inhibitors of apoptosis proteins Cell Cycle 7 1036 1046 PMID 18414036 DOI 10 4161 cc 7 8 5783 Lopez J Meier P 2010 To fight or die inhibitor of apoptosis proteins at the crossroad of innate immunity and death Curr Opin Cell Biol 22 872 881 PMID 20888210 DOI 10 1016 j ceb 2010 08 025 Gyrd Hansen M Meier P 2010 IAPs from caspase inhibitors to modulators of NF kappaB inflammation and cancer Nat Rev Cancer 10 561 574 PMID 20651737 DOI 10 1038 nrc2889PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 15 veresnya 2015 Procitovano 8 veresnya 2017 angl Arhiv originalu za 14 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi