Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CDK9 англ Cyclin dependent kinase 9 білок який кодується однойменним геном розташованим у людей на короткому плечі 9 ї х

Циклін-залежна кіназа 9

Циклін-залежна кіназа 9

CDK9 (англ. Cyclin dependent kinase 9) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми. Довжина поліпептидного ланцюга білка становить 372 амінокислот, а молекулярна маса — 42 778.

CDK9
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CDK9, C-2k, CDC2L4, CTK1, PITALRE, TAK, cyclin-dependent kinase 9, cyclin dependent kinase 9
Зовнішні ІД OMIM: 603251 MGI: 1328368 HomoloGene: 55566 GeneCards: CDK9
Реагує на сполуку
dinaciclib, seliciclib
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
1025
107951
Ensembl
ENSG00000136807
ENSMUSG00000009555
UniProt
P50750
Q99J95
RefSeq (мРНК)
NM_001261
NM_130860
RefSeq (білок)
NP_001252
NP_001252.1
NP_570930
Локус (UCSC) Хр. 9: 127.79 – 127.79 Mb Хр. 2: 32.6 – 32.6 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKV
LMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIY
LVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDM
KAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELL
LGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITP
EVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQIT
QQSTNQSRNPATTNQTEFERVF

Кодований геном білок за функціями належить до трансфераз, кіназ, серин/треонінових протеїнкіназ, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, пошкодження ДНК, репарація ДНК, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, ядрі.

Література

  • Best J.L., Presky D.H., Swerlick R.A., Burns D.K., Chu W. (1995). Cloning of a full-length cDNA sequence encoding a cdc2-related protein kinase from human endothelial cells. Biochem. Biophys. Res. Commun. 208: 562—568. PMID 7695608 DOI:10.1006/bbrc.1995.1375
  • Liu H., Rice A.P. (2000). Genomic organization and characterization of promoter function of the human CDK9 gene. Gene. 252: 51—59. PMID 10903437 DOI:10.1016/S0378-1119(00)00215-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Wei P., Garber M.E., Fang S.-M., Fischer W.H., Jones K.A. (1998). A novel CDK9-associated C-type cyclin interacts directly with HIV-1 Tat and mediates its high-affinity, loop-specific binding to TAR RNA. Cell. 92: 451—462. PMID 9491887 DOI:10.1016/S0092-8674(00)80939-3
  • Wada T., Takagi T., Yamaguchi Y., Watanabe D., Handa H. (1998). Evidence that P-TEFb alleviates the negative effect of DSIF on RNA polymerase II-dependent transcription in vitro. EMBO J. 17: 7395—7403. PMID 9857195 DOI:10.1093/emboj/17.24.7395
  • Peng J.-M., Zhu Y., Milton J.T., Price D.H. (1998). Identification of multiple cyclin subunits of human P-TEFb. Genes Dev. 12: 755—762. PMID 9499409 DOI:10.1101/gad.12.5.755

Примітки

  1. Сполуки, які фізично взаємодіють з Cyclin dependent kinase 9 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:1780 (англ.) . Процитовано 8 вересня 2017.
  5. UniProt, P50750 (англ.) . Процитовано 8 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CDK9 angl Cyclin dependent kinase 9 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 9 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 372 aminokislot a molekulyarna masa 42 778 CDK9Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3BLH 3BLQ 3BLR 3LQ5 3MI9 3MIA 3MY1 3TN8 3TNH 3TNI 4BCF 4BCG 4BCH 4BCI 4BCJ 4EC8 4EC9 4IMY 4OGR 4OR5IdentifikatoriSimvoliCDK9 C 2k CDC2L4 CTK1 PITALRE TAK cyclin dependent kinase 9 cyclin dependent kinase 9Zovnishni ID OMIM 603251 MGI 1328368 HomoloGene 55566 GeneCards CDK9Reaguye na spolukudinaciclib seliciclib Ontologiya genaMolekulyarna funkciya nucleotide binding transferase activity protein kinase activity 7SK snRNA binding transcription coactivator binding snRNA binding ATP binding RNA polymerase II core promoter sequence specific DNA binding DNA binding transcription factor binding GO 0001948 GO 0016582 protein binding protein serine threonine kinase activity chromatin binding kinase activity cyclin dependent protein serine threonine kinase activity RNA polymerase II CTD heptapeptide repeat kinase activity protein kinase binding cyclin binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA bindingKlitinna komponenta citoplazma klitinne yadro membrana nukleoplazma transcription elongation factor complex cyclin CDK positive transcription elongation factor complex PML body hromosoma cytoplasmic ribonucleoprotein granule cyclin dependent protein kinase holoenzyme complexBiologichnij proces positive regulation of cardiac muscle hypertrophy positive regulation of mRNA 3 UTR binding regulation of muscle cell differentiation negative regulation of mRNA polyadenylation GO 0100026 Reparaciya DNK cellular response to cytokine stimulus positive regulation of viral transcription replication fork processing protein phosphorylation GO 0033127 GO 2000281 GO 2000817 regulation of histone modification regulation of mitotic cell cycle cellular response to DNA damage stimulus transcription initiation from RNA polymerase II promoter regulation of DNA repair GO 0009373 regulation of transcription DNA templated proliferaciya transcription by RNA polymerase II fosforilyuvannya positive regulation of histone H2B ubiquitination GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II transcription DNA templated snRNA transcription by RNA polymerase II transcription elongation from RNA polymerase II promoter phosphorylation of RNA polymerase II C terminal domain positive regulation of transcription elongation from RNA polymerase II promoterDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1025 107951Ensembl ENSG00000136807 ENSMUSG00000009555UniProt P50750 Q99J95RefSeq mRNK NM 001261NM 130860RefSeq bilok NP 001252 NP 001252 1NP 570930Lokus UCSC Hr 9 127 79 127 79 MbHr 2 32 6 32 6 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKV LMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIY LVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDM KAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELL LGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITP EVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQIT QQSTNQSRNPATTNQTEFERVF A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do transferaz kinaz serin treoninovih proteyinkinaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi poshkodzhennya DNK reparaciya DNK acetilyuvannya alternativnij splajsing Bilok maye sajt dlya zv yazuvannya z ATF nukleotidami Lokalizovanij u citoplazmi yadri LiteraturaBest J L Presky D H Swerlick R A Burns D K Chu W 1995 Cloning of a full length cDNA sequence encoding a cdc2 related protein kinase from human endothelial cells Biochem Biophys Res Commun 208 562 568 PMID 7695608 DOI 10 1006 bbrc 1995 1375 Liu H Rice A P 2000 Genomic organization and characterization of promoter function of the human CDK9 gene Gene 252 51 59 PMID 10903437 DOI 10 1016 S0378 1119 00 00215 8 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Wei P Garber M E Fang S M Fischer W H Jones K A 1998 A novel CDK9 associated C type cyclin interacts directly with HIV 1 Tat and mediates its high affinity loop specific binding to TAR RNA Cell 92 451 462 PMID 9491887 DOI 10 1016 S0092 8674 00 80939 3 Wada T Takagi T Yamaguchi Y Watanabe D Handa H 1998 Evidence that P TEFb alleviates the negative effect of DSIF on RNA polymerase II dependent transcription in vitro EMBO J 17 7395 7403 PMID 9857195 DOI 10 1093 emboj 17 24 7395 Peng J M Zhu Y Milton J T Price D H 1998 Identification of multiple cyclin subunits of human P TEFb Genes Dev 12 755 762 PMID 9499409 DOI 10 1101 gad 12 5 755PrimitkiSpoluki yaki fizichno vzayemodiyut z Cyclin dependent kinase 9 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1780 angl Procitovano 8 veresnya 2017 UniProt P50750 angl Procitovano 8 veresnya 2017 Div takozhHromosoma 9 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ