IL21 (англ. Interleukin 21) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. Довжина поліпептидного ланцюга білка становить 155 амінокислот, а молекулярна маса — 17 923.
IL21 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | IL21, CVID11, IL-21, Za11, interleukin 21 | ||||||||||||||||
Зовнішні ІД | OMIM: 605384 MGI: 1890474 HomoloGene: 11032 GeneCards: IL21 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 4: 122.61 – 122.62 Mb | Хр. 3: 37.28 – 37.29 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MERIVICLMV | IFLGTLVHKS | SSQGQDRHMI | RMRQLIDIVD | QLKNYVNDLV | ||||
PEFLPAPEDV | ETNCEWSAFS | CFQKAQLKSA | NTGNNERIIN | VSIKKLKRKP | ||||
PSTNAGRRQK | HRLTCPSCDS | YEKKPPKEFL | ERFKSLLQKM | IHQHLSSRTH | ||||
GSEDS |
Кодований геном білок за функцією належить до цитокінів. Задіяний у такому біологічному процесі як альтернативний сплайсинг. Секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Strengell M., Julkunen I., Matikainen S. (2004). IFN-alpha regulates IL-21 and IL-21R expression in human NK and T cells. J. Leukoc. Biol. 76: 416—422. PMID 15178704 DOI:10.1189/jlb.1003488
- Sivakumar P.V., Foster D.C., Clegg C.H. (2004). Interleukin-21 is a T-helper cytokine that regulates humoral immunity and cell-mediated anti-tumour responses. Immunology. 112: 177—182. PMID 15147560 DOI:10.1111/j.1365-2567.2004.01886.x
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:6005 (англ.) . Процитовано 30 серпня 2017.
- (англ.) . Архів оригіналу за 31 серпня 2017. Процитовано 30 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
IL21 angl Interleukin 21 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 4 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 155 aminokislot a molekulyarna masa 17 923 IL21Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2OQP 3TGXIdentifikatoriSimvoliIL21 CVID11 IL 21 Za11 interleukin 21Zovnishni ID OMIM 605384 MGI 1890474 HomoloGene 11032 GeneCards IL21Ontologiya genaMolekulyarna funkciya cytokine activity interleukin 2 receptor binding GO 0005145 cytokine receptor bindingKlitinna komponenta vnutrishnoklitinnij mizhklitinnij prostir extracellular regionBiologichnij proces positive regulation of inflammatory response GO 0032737 positive regulation of cytokine production cell maturation positive regulation of B cell proliferation positive regulation of tissue remodeling positive regulation of T cell proliferation GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of cell population proliferation positive regulation of interleukin 17 production positive regulation of natural killer cell mediated cytotoxicity GO 0072468 signalna transdukciya tyrosine phosphorylation of STAT protein positive regulation of tyrosine phosphorylation of STAT protein regulation of signaling receptor activity interleukin 21 mediated signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez59067 60505Ensembl ENSG00000138684 ENSMUSG00000027718UniProt Q9HBE4 Q9ES17RefSeq mRNK NM 021803 NM 001207006NM 021782 NM 001291041RefSeq bilok NP 001193935 NP 068575NP 001277970 NP 068554Lokus UCSC Hr 4 122 61 122 62 MbHr 3 37 28 37 29 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLV PEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKP PSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTH GSEDS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Zadiyanij u takomu biologichnomu procesi yak alternativnij splajsing Sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Strengell M Julkunen I Matikainen S 2004 IFN alpha regulates IL 21 and IL 21R expression in human NK and T cells J Leukoc Biol 76 416 422 PMID 15178704 DOI 10 1189 jlb 1003488 Sivakumar P V Foster D C Clegg C H 2004 Interleukin 21 is a T helper cytokine that regulates humoral immunity and cell mediated anti tumour responses Immunology 112 177 182 PMID 15147560 DOI 10 1111 j 1365 2567 2004 01886 xPrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6005 angl Procitovano 30 serpnya 2017 angl Arhiv originalu za 31 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 4 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi