FSHB (англ. Follicle stimulating hormone beta subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 129 амінокислот, а молекулярна маса — 14 700.
FSHB | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | FSHB, HH24, follicle stimulating hormone beta subunit, Follitropin subunit beta, follicle stimulating hormone subunit beta | ||||||||||||||||
Зовнішні ІД | OMIM: 136530 MGI: 95582 HomoloGene: 430 GeneCards: FSHB | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
hypogonadotropic hypogonadism 24 without anosmia | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 11: 30.23 – 30.24 Mb | Хр. 2: 106.89 – 106.89 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MKTLQFFFLF | CCWKAICCNS | CELTNITIAI | EKEECRFCIS | INTTWCAGYC | ||||
YTRDLVYKDP | ARPKIQKTCT | FKELVYETVR | VPGCAHHADS | LYTYPVATQC | ||||
HCGKCDSDST | DCTVRGLGPS | YCSFGEMKE |
Кодований геном білок за функцією належить до гормонів. Секретований назовні.
Література
- Jameson J.L., Becker C.B., Lindell C.M., Habener J.F. (1988). Human follicle-stimulating hormone beta-subunit gene encodes multiple messenger ribonucleic acids. Mol. Endocrinol. 2: 806—815. PMID 3139991 DOI:10.1210/mend-2-9-806
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Shome B., Parlow A.F. (1974). Human follicle stimulating hormone: first proposal for the amino acid sequence of the hormone-specific, beta subunit (hFSHb). J. Clin. Endocrinol. Metab. 39: 203—205. PMID 4835136 DOI:10.1210/jcem-39-1-203
- Fujiki Y., Rathnam P., Saxena B.B. (1980). Studies on the disulfide bonds in human pituitary follicle-stimulating hormone. Biochim. Biophys. Acta. 624: 428—435. PMID 6774759 DOI:10.1016/0005-2795(80)90084-7
- Fox K.M., Dias J.A., Van Roey P. (2001). Three-dimensional structure of human follicle-stimulating hormone. Mol. Endocrinol. 15: 378—389. PMID 11222739 DOI:10.1210/mend.15.3.0603
- Fan Q.R., Hendrickson W.A. (2005). Structure of human follicle-stimulating hormone in complex with its receptor. Nature. 433: 269—277. PMID 15662415 DOI:10.1038/nature03206
Примітки
- Захворювання, генетично пов'язані з FSHB переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 3 квітня 2016. Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 14 вересня 2017. Процитовано 8 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FSHB angl Follicle stimulating hormone beta subunit bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 129 aminokislot a molekulyarna masa 14 700 FSHBNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1FL7 1XWD 4AY9 4MQWIdentifikatoriSimvoliFSHB HH24 follicle stimulating hormone beta subunit Follitropin subunit beta follicle stimulating hormone subunit betaZovnishni ID OMIM 136530 MGI 95582 HomoloGene 430 GeneCards FSHBPov yazani genetichni zahvoryuvannyahypogonadotropic hypogonadism 24 without anosmia Ontologiya genaMolekulyarna funkciya follicle stimulating hormone activity GO 0001948 GO 0016582 protein binding hormone activityKlitinna komponenta citoplazma extracellular region mizhklitinnij prostir follicle stimulating hormone complexBiologichnij proces progesterone biosynthetic process female gamete generation positive regulation of bone resorption regulation of osteoclast differentiation transforming growth factor beta receptor signaling pathway positive regulation of cell migration GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II zhinocha vagitnist positive regulation of cell population proliferation ovarian follicle development Sertoli cell proliferation GO 0072468 signalna transdukciya peptide hormone processing GO 1901313 positive regulation of gene expression cell cell signaling hormone mediated signaling pathway follicle stimulating hormone signaling pathway regulation of signaling receptor activity G protein coupled receptor signaling pathway positive regulation of steroid biosynthetic processDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2488 14308Ensembl ENSG00000131808 ENSMUSG00000027120UniProt P01225 Q60687RefSeq mRNK NM 000510 NM 001018080 NM 001382289NM 008045RefSeq bilok NP 000501 NP 001018090 NP 001369218NP 032071Lokus UCSC Hr 11 30 23 30 24 MbHr 2 106 89 106 89 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYC YTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQC HCGKCDSDSTDCTVRGLGPSYCSFGEMKE A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Sekretovanij nazovni LiteraturaJameson J L Becker C B Lindell C M Habener J F 1988 Human follicle stimulating hormone beta subunit gene encodes multiple messenger ribonucleic acids Mol Endocrinol 2 806 815 PMID 3139991 DOI 10 1210 mend 2 9 806 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Shome B Parlow A F 1974 Human follicle stimulating hormone first proposal for the amino acid sequence of the hormone specific beta subunit hFSHb J Clin Endocrinol Metab 39 203 205 PMID 4835136 DOI 10 1210 jcem 39 1 203 Fujiki Y Rathnam P Saxena B B 1980 Studies on the disulfide bonds in human pituitary follicle stimulating hormone Biochim Biophys Acta 624 428 435 PMID 6774759 DOI 10 1016 0005 2795 80 90084 7 Fox K M Dias J A Van Roey P 2001 Three dimensional structure of human follicle stimulating hormone Mol Endocrinol 15 378 389 PMID 11222739 DOI 10 1210 mend 15 3 0603 Fan Q R Hendrickson W A 2005 Structure of human follicle stimulating hormone in complex with its receptor Nature 433 269 277 PMID 15662415 DOI 10 1038 nature03206PrimitkiZahvoryuvannya genetichno pov yazani z FSHB pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 3 kvitnya 2016 Procitovano 8 veresnya 2017 angl Arhiv originalu za 14 veresnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi