UCN (англ. Urocortin) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 124 амінокислот, а молекулярна маса — 13 458.
UCN | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | UCN, UI, UROC, urocortin | ||||||||||||||||
Зовнішні ІД | OMIM: 600945 MGI: 1276123 HomoloGene: 2515 GeneCards: UCN | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 2: 27.31 – 27.31 Mb | Хр. 5: 31.3 – 31.3 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MRQAGRAALL | AALLLLVQLC | PGSSQRSPEA | AGVQDPSLRW | SPGARNQGGG | ||||
ARALLLLLAE | RFPRRAGPGR | LGLGTAGERP | RRDNPSLSID | LTFHLLRTLL | ||||
ELARTQSQRE | RAEQNRIIFD | SVGK |
Кодований геном білок за функцією належить до гормонів. Секретований назовні.
Література
- Zhao L., Donaldson C.J., Smith G.W., Vale W.W. (1998). The structures of the mouse and human urocortin genes (Ucn and UCN). Genomics. 50: 23—33. PMID 9628819 DOI:10.1006/geno.1998.5292
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Pal K., Swaminathan K., Xu H.E., Pioszak A.A. (2010). Structural basis for hormone recognition by the Human CRFR2{alpha} G protein-coupled receptor. J. Biol. Chem. 285: 40351—40361. PMID 20966082 DOI:10.1074/jbc.M110.186072
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:12516 (англ.) . Процитовано 28 серпня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 28 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
UCN angl Urocortin bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 124 aminokislot a molekulyarna masa 13 458 UCNNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2RMF 3N96IdentifikatoriSimvoliUCN UI UROC urocortinZovnishni ID OMIM 600945 MGI 1276123 HomoloGene 2515 GeneCards UCNOntologiya genaMolekulyarna funkciya histone deacetylase inhibitor activity hormone activity GO 0001948 GO 0016582 protein binding nejropeptidna gormonalna aktivnist G protein coupled receptor binding corticotropin releasing hormone receptor 1 binding corticotropin releasing hormone receptor 2 binding corticotropin releasing hormone activityKlitinna komponenta axon terminus perikarion varicosity akson dendrit nejrobiologiya neuronal cell body extracellular region mizhklitinnij prostirBiologichnij proces positive regulation of collagen biosynthetic process G protein coupled receptor signaling pathway negative regulation of histone deacetylation activation of protein kinase A activity response to estradiol positive regulation of protein phosphorylation associative learning perelyak gastric emptying negative regulation of blood pressure zhinocha vagitnist negative regulation of gastric acid secretion negative regulation of apoptotic process response to glucocorticoid sluh pancreatic juice secretion GO 0001306 response to oxidative stress negative regulation of appetite positive regulation of translation negative regulation of gene expression negative regulation of cell death positive regulation of peptidyl serine phosphorylation positive regulation of DNA replication aerobic respiration positive regulation of calcium ion import positive regulation of cell growth positive regulation of vascular permeability GO 1901313 positive regulation of gene expression drinking behavior response to pain positive regulation of cardiac muscle contraction harchova povedinka positive regulation of interleukin 6 production response to auditory stimulus learning or memory socialna povedinka regulation of synaptic transmission glutamatergic inflammatory response neuropeptide signaling pathway neuron projection development negative regulation of necrotic cell death positive regulation of behavioral fear response negative regulation of cell size GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of neuron death negative regulation of hormone secretion negative regulation of feeding behavior regulation of signaling receptor activity positive regulation of cAMP mediated signaling positive regulation of corticotropin secretion negative regulation of epinephrine secretion positive regulation of cortisol secretion negative regulation of glucagon secretionDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez7349 22226Ensembl ENSG00000163794 ENSMUSG00000038676UniProt P55089 P81615RefSeq mRNK NM 003353NM 021290 NM 001346010RefSeq bilok NP 003344NP 001332939 NP 067265Lokus UCSC Hr 2 27 31 27 31 MbHr 5 31 3 31 3 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGG ARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLL ELARTQSQRERAEQNRIIFDSVGK A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Sekretovanij nazovni LiteraturaZhao L Donaldson C J Smith G W Vale W W 1998 The structures of the mouse and human urocortin genes Ucn and UCN Genomics 50 23 33 PMID 9628819 DOI 10 1006 geno 1998 5292 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Pal K Swaminathan K Xu H E Pioszak A A 2010 Structural basis for hormone recognition by the Human CRFR2 alpha G protein coupled receptor J Biol Chem 285 40351 40361 PMID 20966082 DOI 10 1074 jbc M110 186072PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 12516 angl Procitovano 28 serpnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi