BGLAP (англ. Bone gamma-carboxyglutamate protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 100 амінокислот, а молекулярна маса — 10 963.
BGLAP | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | BGLAP, BGP, OC, OCN, bone gamma-carboxyglutamate protein, Osteocalcin | ||||||||||||||||
Зовнішні ІД | OMIM: 112260 MGI: 88155 HomoloGene: 104130 GeneCards: BGLAP | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 156.24 – 156.24 Mb | Хр. 3: 88.28 – 88.28 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MRALTLLALL | ALAALCIAGQ | AGAKPSGAES | SKGAAFVSKQ | EGSEVVKRPR | ||||
RYLYQWLGAP | VPYPDPLEPR | REVCELNPDC | DELADHIGFQ | EAYRRFYGPV | ||||
Білок має сайт для зв'язування з іонами металів, іоном кальцію. Секретований назовні.
Література
- Kiefer M.C., Saphire A.C.S., Bauer D.M., Barr P.J. (1990). The cDNA and derived amino acid sequences of human and bovine bone Gla protein. Nucleic Acids Res. 18: 1909—1909. PMID 2336375 DOI:10.1093/nar/18.7.1909
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Celeste A.J., Buecker J.L., Kriz R., Wang E.A., Wozney J.M. (1986). Isolation of the human gene for bone gla protein utilizing mouse and rat cDNA clones. EMBO J. 5: 1885—1890. PMID 3019668
- Poser J.W., Esch F.S., Ling N.C., Price P.A. (1980). Isolation and sequence of the vitamin K-dependent protein from human bone. Undercarboxylation of the first glutamic acid residue. J. Biol. Chem. 255: 8685—8691. PMID 6967872
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1043 (англ.) . Процитовано 25 серпня 2017.
- UniProt, P02818 (англ.) . Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
BGLAP angl Bone gamma carboxyglutamate protein bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 100 aminokislot a molekulyarna masa 10 963 BGLAPIdentifikatoriSimvoliBGLAP BGP OC OCN bone gamma carboxyglutamate protein OsteocalcinZovnishni ID OMIM 112260 MGI 88155 HomoloGene 104130 GeneCards BGLAPOntologiya genaMolekulyarna funkciya calcium ion binding structural molecule activity zv yazuvannya z ionom metalu hydroxyapatite binding structural constituent of boneKlitinna komponenta citoplazma perikarion rough endoplasmic reticulum kompleks Goldzhi cell projection endoplasmic reticulum lumen extracellular region dendrit nejrobiologiya Golgi lumen mizhklitinnij prostir vezikulaBiologichnij proces skeletal system development bone mineralization response to vitamin D GO 1904578 response to organic cyclic compound osifikaciya response to testosterone regulation of bone mineralization biomineral tissue development cellular response to growth factor stimulus response to mechanical stimulus GO 0010260 starinnya lyudini response to zinc ion response to glucocorticoid cellular response to vitamin D response to activity response to estrogen odontogenesis endoplasmic reticulum to Golgi vesicle mediated transport response to gravity response to vitamin K response to hydroxyisoflavone adgeziya klitin response to nutrient levels regulation of osteoclast differentiation osteoblast differentiation response to inorganic substance osteoblast development response to ethanol regulation of bone resorption bone development regulation of cellular response to insulin stimulusDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez632 12095Ensembl ENSG00000242252 ENSMUSG00000074489UniProt P02818 P54615RefSeq mRNK NM 199173NM 031368 NM 001305448 NM 001305449 NM 001305450RefSeq bilok NP 954642NP 001292377 NP 001292378 NP 001292379 NP 112736Lokus UCSC Hr 1 156 24 156 24 MbHr 3 88 28 88 28 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPR RYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom kalciyu Sekretovanij nazovni LiteraturaKiefer M C Saphire A C S Bauer D M Barr P J 1990 The cDNA and derived amino acid sequences of human and bovine bone Gla protein Nucleic Acids Res 18 1909 1909 PMID 2336375 DOI 10 1093 nar 18 7 1909 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Celeste A J Buecker J L Kriz R Wang E A Wozney J M 1986 Isolation of the human gene for bone gla protein utilizing mouse and rat cDNA clones EMBO J 5 1885 1890 PMID 3019668 Poser J W Esch F S Ling N C Price P A 1980 Isolation and sequence of the vitamin K dependent protein from human bone Undercarboxylation of the first glutamic acid residue J Biol Chem 255 8685 8691 PMID 6967872PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1043 angl Procitovano 25 serpnya 2017 UniProt P02818 angl Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi