Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

Компонент 1q системи комплементу англ Complement C1q binding protein білок який кодується геном C1QBP розташованим у люд

Компонент 1q системи комплементу

Компонент 1q системи комплементу

Компонент 1q системи комплементу (англ. Complement C1q binding protein) – білок, який кодується геном C1QBP, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 282 амінокислот, а молекулярна маса — 31 362.

Компонент 1 системи комплементу
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи C1QBP, GHABP1, SF2p32, gC1Q-R, gC1qR, p32, complement component 1, q subcomponent binding protein, complement C1q binding protein, COXPD33, SF2AP32
Зовнішні ІД OMIM: 601269 MGI: 1194505 HomoloGene: 31023 GeneCards: C1QBP
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
708
12261
Ensembl
ENSG00000108561
ENSMUSG00000018446
UniProt
Q07021
O35658
Q8R5L1
RefSeq (мРНК)
NM_001212
NM_007573
RefSeq (білок)
NP_001203
NP_031599
Локус (UCSC) Хр. 17: 5.43 – 5.45 Mb Хр. 11: 70.87 – 70.87 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRA
GSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHK
TLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPS
QGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE
SDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDN
TFADELVELSTALEHQEYITFLEDLKSFVKSQ

Задіяний у таких біологічних процесах як апоптоз, адаптивний та вроджений імунітет, взаємодія хазяїн-вірус, процесінг мРНК, сплайсінг мРНК, транскрипція, регуляція транскрипції, шлях активації комплементу, біогенез рибосом.

Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані мітохондрії.

Також секретований назовні.

Література

  • Ghebrehiwet B., Lim B.L., Peerschke E.I., Willis A.C., Reid K.B. (1994). Isolation, cDNA cloning, and overexpression of a 33-kD cell surface glycoprotein that binds to the globular 'heads' of C1q. J. Exp. Med. 179: 1809—1821. PMID 8195709 DOI:10.1084/jem.179.6.1809
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Krainer A.R., Mayeda A., Kozak D., Binns G. (1991). Functional expression of cloned human splicing factor SF2: homology to RNA-binding proteins, U1 70K, and Drosophila splicing regulators. Cell. 66: 383—394. PMID 1830244 DOI:10.1016/0092-8674(91)90627-B
  • Herwald H., Dedio J., Kellner R., Loos M., Muller-Esterl W. (1996). Isolation and characterization of the kininogen-binding protein p33 from endothelial cells. Identity with the gC1q receptor. J. Biol. Chem. 271: 13040—13047. PMID 8662673 DOI:10.1074/jbc.271.22.13040
  • Deb T.B., Datta K. (1996). Molecular cloning of human fibroblast hyaluronic acid-binding protein confirms its identity with P-32, a protein co-purified with splicing factor SF2. Hyaluronic acid-binding protein as P-32 protein, co-purified with splicing factor SF2. J. Biol. Chem. 271: 2206—2212. PMID 8567680 DOI:10.1074/jbc.271.4.2206
  • Joseph K., Ghebrehiwet B., Peerschke E.I., Reid K.B., Kaplan A.P. (1996). Identification of the zinc-dependent endothelial cell binding protein for high molecular weight kininogen and factor XII: identity with the receptor that binds to the globular 'heads' of C1q (gC1q-R). Proc. Natl. Acad. Sci. U.S.A. 93: 8552—8557. PMID 8710908 DOI:10.1073/pnas.93.16.8552

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 25 Березня 2016. Процитовано 30 січня 2017.
  4. (англ.) . Архів оригіналу за 26 Лютого 2017. Процитовано 30 січня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

Komponent 1q sistemi komplementu angl Complement C1q binding protein bilok yakij koduyetsya genom C1QBP roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 282 aminokislot a molekulyarna masa 31 362 Komponent 1 sistemi komplementuNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1P32 3RPXIdentifikatoriSimvoliC1QBP GHABP1 SF2p32 gC1Q R gC1qR p32 complement component 1 q subcomponent binding protein complement C1q binding protein COXPD33 SF2AP32Zovnishni ID OMIM 601269 MGI 1194505 HomoloGene 31023 GeneCards C1QBPOntologiya genaMolekulyarna funkciya GO 0001106 transcription corepressor activity transcription factor binding GO 0001948 GO 0016582 protein binding hyaluronic acid binding kininogen binding mitochondrial ribosome binding mRNA binding protein kinase C binding complement component C1q complex binding adrenergic receptor binding translation activator activityKlitinna komponenta gialoplazma extracellular region cell surface mitohondrialnij matriks yaderce citoplazma membrana mitohondriya klitinne yadro mizhklitinnij prostir klitinna membrana presynaptic active zone presynapse glutamatergic synapse GABA ergic synapseBiologichnij proces blood coagulation intrinsic pathway positive regulation of mitochondrial translation negative regulation of interferon gamma production positive regulation of protein kinase B signaling negative regulation of MDA 5 signaling pathway GO 0009373 regulation of transcription DNA templated adaptivna imunna vidpovid ribosome biogenesis negative regulation of defense response to virus proces imunnoyi sistemi mRNA processing GO 1901227 negative regulation of transcription by RNA polymerase II transcription DNA templated positive regulation of trophoblast cell migration positive regulation of substrate adhesion dependent cell spreading mature ribosome assembly negative regulation of mRNA splicing via spliceosome GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid Splajsing RNK positive regulation of neutrophil chemotaxis complement activation classical pathway positive regulation of apoptotic process phosphatidylinositol 3 kinase signaling vrodzhenij imunitet GO 0022415 viral process positive regulation of dendritic cell chemotaxis regulation of complement activation negative regulation of RIG I signaling pathway positive regulation of cell adhesion negative regulation of interleukin 12 production GO 0097285 apoptozDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez708 12261Ensembl ENSG00000108561 ENSMUSG00000018446UniProt Q07021 O35658 Q8R5L1RefSeq mRNK NM 001212NM 007573RefSeq bilok NP 001203NP 031599Lokus UCSC Hr 17 5 43 5 45 MbHr 11 70 87 70 87 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak apoptoz adaptivnij ta vrodzhenij imunitet vzayemodiya hazyayin virus procesing mRNK splajsing mRNK transkripciya regulyaciya transkripciyi shlyah aktivaciyi komplementu biogenez ribosom Lokalizovanij u klitinnij membrani citoplazmi yadri membrani mitohondriyi Takozh sekretovanij nazovni LiteraturaGhebrehiwet B Lim B L Peerschke E I Willis A C Reid K B 1994 Isolation cDNA cloning and overexpression of a 33 kD cell surface glycoprotein that binds to the globular heads of C1q J Exp Med 179 1809 1821 PMID 8195709 DOI 10 1084 jem 179 6 1809 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Krainer A R Mayeda A Kozak D Binns G 1991 Functional expression of cloned human splicing factor SF2 homology to RNA binding proteins U1 70K and Drosophila splicing regulators Cell 66 383 394 PMID 1830244 DOI 10 1016 0092 8674 91 90627 B Herwald H Dedio J Kellner R Loos M Muller Esterl W 1996 Isolation and characterization of the kininogen binding protein p33 from endothelial cells Identity with the gC1q receptor J Biol Chem 271 13040 13047 PMID 8662673 DOI 10 1074 jbc 271 22 13040 Deb T B Datta K 1996 Molecular cloning of human fibroblast hyaluronic acid binding protein confirms its identity with P 32 a protein co purified with splicing factor SF2 Hyaluronic acid binding protein as P 32 protein co purified with splicing factor SF2 J Biol Chem 271 2206 2212 PMID 8567680 DOI 10 1074 jbc 271 4 2206 Joseph K Ghebrehiwet B Peerschke E I Reid K B Kaplan A P 1996 Identification of the zinc dependent endothelial cell binding protein for high molecular weight kininogen and factor XII identity with the receptor that binds to the globular heads of C1q gC1q R Proc Natl Acad Sci U S A 93 8552 8557 PMID 8710908 DOI 10 1073 pnas 93 16 8552PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 25 Bereznya 2016 Procitovano 30 sichnya 2017 angl Arhiv originalu za 26 Lyutogo 2017 Procitovano 30 sichnya 2017 Div takozhHromosoma 17Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ