Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

GNRH1 англ Gonadotropin releasing hormone 1 білок який кодується однойменним геном розташованим у людей на короткому пле

Гонадоліберин

Гонадоліберин

GNRH1 (англ. Gonadotropin releasing hormone 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми. Довжина поліпептидного ланцюга білка становить 92 амінокислот, а молекулярна маса — 10 380.

GNRH1
image
Ідентифікатори
Символи GNRH1, GNRH, GRH, HH12, LHRH, LNRH, gonadotropin releasing hormone 1, Gonadotropin-Releasing Hormone
Зовнішні ІД OMIM: 152760 MGI: 95789 HomoloGene: 641 GeneCards: GNRH1
Пов'язані генетичні захворювання
hypogonadotropic hypogonadism 12 with or without anosmia
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
2796
14714
Ensembl
ENSG00000147437
ENSMUSG00000015812
UniProt
P01148
P13562
RefSeq (мРНК)
NM_001083111
NM_000825
NM_008145
RefSeq (білок)
NP_000816
NP_001076580
NP_032171
Локус (UCSC) Хр. 8: 25.42 – 25.42 Mb Хр. 14: 67.98 – 67.99 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVK
EVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

Кодований геном білок належить до гормонів. Секретується гіпоталамусом. Одна з 3 ізоформ гормону.

Література

  • Hayflick J.S., Adelman J.P., Seeburg P.H. (1989). The complete nucleotide sequence of the human gonadotropin-releasing hormone gene. Nucleic Acids Res. 17: 6403—6403. PMID 2671939 DOI:10.1093/nar/17.15.6403
  • Adelman J.P., Mason A.J., Hayflick J.S., Seeburg P.H. (1986). Isolation of the gene and hypothalamic cDNA for the common precursor of gonadotropin-releasing hormone and prolactin release-inhibiting factor in human and rat. Proc. Natl. Acad. Sci. U.S.A. 83: 179—183. PMID 2867548 DOI:10.1073/pnas.83.1.179
  • Seeburg P.H., Adelman J.P. (1984). Characterization of cDNA for precursor of human luteinizing hormone releasing hormone. Nature. 311: 666—668. PMID 6090951 DOI:10.1038/311666a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Tan L., Rousseau P. (1982). The chemical identity of the immunoreactive LHRH-like peptide biosynthesized in the human placenta. Biochem. Biophys. Res. Commun. 109: 1061—1071. PMID 6760865 DOI:10.1016/0006-291X(82)92047-2

Примітки

  1. Захворювання, генетично пов'язані з GNRH1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 13 червня 2017. Процитовано 7 вересня 2017.
  5. (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 7 вересня 2017.
  6. Robert P. , Zhi-Liang Lu, Adam J. Pawson, Colleen A. Flanagan, Kevin Morgan, Stuart R. Maudsley, Gonadotropin-Releasing Hormone Receptors, Endocrine Reviews, Volume 25, Issue 2, 1 April 2004, Pages 235–275, https://doi.org/10.1210/er.2003-0002 (англ.)

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

GNRH1 angl Gonadotropin releasing hormone 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 8 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 92 aminokislot a molekulyarna masa 10 380 GNRH1IdentifikatoriSimvoliGNRH1 GNRH GRH HH12 LHRH LNRH gonadotropin releasing hormone 1 Gonadotropin Releasing HormoneZovnishni ID OMIM 152760 MGI 95789 HomoloGene 641 GeneCards GNRH1Pov yazani genetichni zahvoryuvannyahypogonadotropic hypogonadism 12 with or without anosmiaOntologiya genaMolekulyarna funkciya hormone activity gonadotropin hormone releasing hormone activity gonadotropin releasing hormone receptor bindingKlitinna komponenta axon terminus perikarion Golgi associated vesicle extracellular region neurosecretory vesicle dendrit nejrobiologiya mitohondriya neuron projection cytoplasmic side of rough endoplasmic reticulum membrane mizhklitinnij prostirBiologichnij proces negative regulation of immature T cell proliferation response to prolactin negative regulation of neuron migration response to potassium ion GO 1904578 response to organic cyclic compound response to testosterone estrus zhinocha vagitnist cell cell signaling response to steroid hormone GO 0010260 starinnya lyudini response to peptide hormone negative regulation of apoptotic process male sex determination multicellular organism development response to prostaglandin E response to lipopolysaccharide response to corticosteroid regulyaciya ekspresiyi geniv ovulation cycle response to ethanol regulation of ovarian follicle development GO 0072468 signalna transdukciya negative regulation of cell population proliferation regulation of signaling receptor activity G protein coupled receptor signaling pathway rozmnozhennyaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2796 14714Ensembl ENSG00000147437 ENSMUSG00000015812UniProt P01148 P13562RefSeq mRNK NM 001083111 NM 000825NM 008145RefSeq bilok NP 000816 NP 001076580NP 032171Lokus UCSC Hr 8 25 42 25 42 MbHr 14 67 98 67 99 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKIA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok nalezhit do gormoniv Sekretuyetsya gipotalamusom Odna z 3 izoform gormonu LiteraturaHayflick J S Adelman J P Seeburg P H 1989 The complete nucleotide sequence of the human gonadotropin releasing hormone gene Nucleic Acids Res 17 6403 6403 PMID 2671939 DOI 10 1093 nar 17 15 6403 Adelman J P Mason A J Hayflick J S Seeburg P H 1986 Isolation of the gene and hypothalamic cDNA for the common precursor of gonadotropin releasing hormone and prolactin release inhibiting factor in human and rat Proc Natl Acad Sci U S A 83 179 183 PMID 2867548 DOI 10 1073 pnas 83 1 179 Seeburg P H Adelman J P 1984 Characterization of cDNA for precursor of human luteinizing hormone releasing hormone Nature 311 666 668 PMID 6090951 DOI 10 1038 311666a0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Tan L Rousseau P 1982 The chemical identity of the immunoreactive LHRH like peptide biosynthesized in the human placenta Biochem Biophys Res Commun 109 1061 1071 PMID 6760865 DOI 10 1016 0006 291X 82 92047 2PrimitkiZahvoryuvannya genetichno pov yazani z GNRH1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 13 chervnya 2017 Procitovano 7 veresnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 7 veresnya 2017 Robert P Zhi Liang Lu Adam J Pawson Colleen A Flanagan Kevin Morgan Stuart R Maudsley Gonadotropin Releasing Hormone Receptors Endocrine Reviews Volume 25 Issue 2 1 April 2004 Pages 235 275 https doi org 10 1210 er 2003 0002 angl Div takozhHromosoma 8Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ