Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
FOLR2 (англ. Folate receptor beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. Довжина поліпептидного ланцюга білка становить 255 амінокислот, а молекулярна маса — 29 280.
| FOLR2 | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | FOLR2, BETA-HFR, FBP, FBP/PL-1, FR-BETA, FR-P3, folate receptor beta, FRbeta, FOLR1 | ||||||||||||||||
| Зовнішні ІД | OMIM: 136425 MGI: 95569 HomoloGene: 627 GeneCards: FOLR2 | ||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
 | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 11: 72.22 – 72.22 Mb | Хр. 7: 101.49 – 101.51 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MVWKWMPLLL | LLVCVATMCS | AQDRTDLLNV | CMDAKHHKTK | PGPEDKLHDQ | ||||
| CSPWKKNACC | TASTSQELHK | DTSRLYNFNW | DHCGKMEPAC | KRHFIQDTCL | ||||
| YECSPNLGPW | IQQVNQSWRK | ERFLDVPLCK | EDCQRWWEDC | HTSHTCKSNW | ||||
| HRGWDWTSGV | NKCPAGALCR | TFESYFPTPA | ALCEGLWSHS | YKVSNYSRGS | ||||
| GRCIQMWFDS | AQGNPNEEVA | RFYAAAMHVN | AGEMLHGTGG | LLLSLALMLQ | ||||
| LWLLG |
Кодований геном білок за функцією належить до рецепторів. Задіяний у такому біологічному процесі, як транспорт. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.
Література
- Page S.T., Owen W.C., Price K., Elwood P.C. (1993). Expression of the human placental folate receptor transcript is regulated in human tissues. Organization and full nucleotide sequence of the gene. J. Mol. Biol. 229: 1175—1183. PMID 8445646 DOI:10.1006/jmbi.1993.1116
- Ratnam M., Marquardt H., Duhring J.L., Freisheim J.H. (1989). Homologous membrane folate binding proteins in human placenta: cloning and sequence of a cDNA. Biochemistry. 28: 8249—8254. PMID 2605182 DOI:10.1021/bi00446a042
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Freisheim J.H., Price E.M., Ratnam M. (1989). Folate coenzyme and antifolate transport proteins in normal and neoplastic cells. Adv. Enzyme Regul. 29: 13—26. PMID 2561247 DOI:10.1016/0065-2571(89)90091-5
- Yan W., Ratnam M. (1995). Preferred sites of glycosylphosphatidylinositol modification in folate receptors and constraints in the primary structure of the hydrophobic portion of the signal. Biochemistry. 34: 14594—14600. PMID 7578066 DOI:10.1021/bi00044a039
- Wang J., Shen F., Yan W., Wu M., Ratnam M. (1997). Proteolysis of the carboxyl-terminal GPI signal independent of GPI modification as a mechanism for selective protein secretion. Biochemistry. 36: 14583—14592. PMID 9398177 DOI:10.1021/bi970845w
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 4 квітня 2016. Процитовано 8 вересня 2017.
- (англ.) . Архів оригіналу за 24 липня 2017. Процитовано 8 вересня 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
FOLR2 angl Folate receptor beta bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 11 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 255 aminokislot a molekulyarna masa 29 280 FOLR2Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB4KMY 4KMZ 4KN0 4KN1 4KN2IdentifikatoriSimvoliFOLR2 BETA HFR FBP FBP PL 1 FR BETA FR P3 folate receptor beta FRbeta FOLR1Zovnishni ID OMIM 136425 MGI 95569 HomoloGene 627 GeneCards FOLR2Ontologiya genaMolekulyarna funkciya methotrexate binding folic acid binding folic acid receptor activity signaling receptor activityKlitinna komponenta cell surface anchored component of membrane anchored component of external side of plasma membrane membrana extracellular region klitinna membranaBiologichnij proces inflammatory response receptor oposeredkovanij endocitoz positive regulation of cell population proliferation monocyte chemotaxis cellular response to folic acid folic acid metabolic process folic acid transport folate import across plasma membrane adgeziya klitin fusion of sperm to egg plasma membrane involved in single fertilization sperm egg recognitionDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez2350 14276Ensembl ENSG00000165457 ENSMUSG00000032725UniProt P14207 Q05685RefSeq mRNK NM 000803 NM 001113534 NM 001113535 NM 001113536NM 008035 NM 001303231 NM 001303239RefSeq bilok NP 000794 NP 001107006 NP 001107007 NP 001107008NP 001290160 NP 001290168 NP 032061Lokus UCSC Hr 11 72 22 72 22 MbHr 7 101 49 101 51 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQ CSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCL YECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNW HRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGS GRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGGLLLSLALMLQ LWLLG A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do receptoriv Zadiyanij u takomu biologichnomu procesi yak transport Lokalizovanij u klitinnij membrani membrani Takozh sekretovanij nazovni LiteraturaPage S T Owen W C Price K Elwood P C 1993 Expression of the human placental folate receptor transcript is regulated in human tissues Organization and full nucleotide sequence of the gene J Mol Biol 229 1175 1183 PMID 8445646 DOI 10 1006 jmbi 1993 1116 Ratnam M Marquardt H Duhring J L Freisheim J H 1989 Homologous membrane folate binding proteins in human placenta cloning and sequence of a cDNA Biochemistry 28 8249 8254 PMID 2605182 DOI 10 1021 bi00446a042 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Freisheim J H Price E M Ratnam M 1989 Folate coenzyme and antifolate transport proteins in normal and neoplastic cells Adv Enzyme Regul 29 13 26 PMID 2561247 DOI 10 1016 0065 2571 89 90091 5 Yan W Ratnam M 1995 Preferred sites of glycosylphosphatidylinositol modification in folate receptors and constraints in the primary structure of the hydrophobic portion of the signal Biochemistry 34 14594 14600 PMID 7578066 DOI 10 1021 bi00044a039 Wang J Shen F Yan W Wu M Ratnam M 1997 Proteolysis of the carboxyl terminal GPI signal independent of GPI modification as a mechanism for selective protein secretion Biochemistry 36 14583 14592 PMID 9398177 DOI 10 1021 bi970845wPrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 4 kvitnya 2016 Procitovano 8 veresnya 2017 angl Arhiv originalu za 24 lipnya 2017 Procitovano 8 veresnya 2017 Div takozhHromosoma 11 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi