Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

Ангіотензиноген англ Angiotensinogen білок який кодується геном AGT розташованим у людей на короткому плечі першої хромо

Ангіотензиноген

Ангіотензиноген

Ангіотензиноген (англ. Angiotensinogen) – білок, який кодується геном AGT, розташованим у людей на короткому плечі першої хромосоми. Довжина поліпептидного ланцюга білка становить 485 амінокислот, а молекулярна маса — 53 154.

ангіотензиноген
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи AGT, ANHU, SERPINA8, hFLT1, angiotensinogen
Зовнішні ІД MGI: 87963 HomoloGene: 14 GeneCards: AGT
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
183
11606
Ensembl
ENSG00000135744
ENSMUSG00000031980
UniProt
P01019
P11859
Q3UTR7
RefSeq (мРНК)
NM_000029
NM_001382817
NM_001384479
NM_007428
RefSeq (білок)
NP_000020
NP_001369746
NP_031454
Локус (UCSC) Хр. 1: 230.69 – 230.75 Mb Хр. 8: 125.28 – 125.3 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNEST
CEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDK
LRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGA
LDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQ
AQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEK
IDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYA
SDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAE
LPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQLNKPE
VLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTA

Цей білок за функціями належить до , (має судинозвужуючий ефект). Регулятор артеріального тиску та водно-сольового обміну організму. Секретований назовні.

Див. також

Література

  • Kageyama R., Ohkubo H., Nakanishi S. (1984). Primary structure of human preangiotensinogen deduced from the cloned cDNA sequence. Biochemistry. 23: 3603—3609. PMID 6089875 DOI:10.1021/bi00311a006
  • Gaillard I., Clauser E., Corvol P. (1989). Structure of human angiotensinogen gene. DNA. 8: 87—99. PMID 2924688 DOI:10.1089/dna.1.1989.8.87
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kunapuli S.P., Kumar A. (1987). Molecular cloning of human angiotensinogen cDNA and evidence for the presence of its mRNA in rat heart. Circ. Res. 60: 786—790. PMID 2885106 DOI:10.1161/01.RES.60.5.786
  • Kunapuli S.P., Benedict C.R., Kumar A. (1987). Tissue specific hormonal regulation of the rat angiotensinogen gene expression. Arch. Biochem. Biophys. 254: 642—646. PMID 3579322 DOI:10.1016/0003-9861(87)90148-2
  • Tewksbury D.A., Dart R.A., Travis J. (1981). The amino terminal amino acid sequence of human angiotensinogen. Biochem. Biophys. Res. Commun. 99: 1311—1315. PMID 7259779 DOI:10.1016/0006-291X(81)90762-2

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 20 травня 2017. Процитовано 30 січня 2017.
  4. (англ.) . Архів оригіналу за 27 січня 2017. Процитовано 30 січня 2017.


image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

Angiotenzinogen angl Angiotensinogen bilok yakij koduyetsya genom AGT roztashovanim u lyudej na korotkomu plechi pershoyi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 485 aminokislot a molekulyarna masa 53 154 angiotenzinogenNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB2WXW 2X0B 4APH s1N9U 1N9V s1N9V 1N9U 3CK0 4AA1 4APH 5E2QIdentifikatoriSimvoliAGT ANHU SERPINA8 hFLT1 angiotensinogenZovnishni ID MGI 87963 HomoloGene 14 GeneCards AGTOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding serine type endopeptidase inhibitor activity type 1 angiotensin receptor binding hormone activity superoxide generating NADPH oxidase activator activity growth factor activity type 2 angiotensin receptor binding sodium channel regulator activity angiotensin receptor binding receptor ligand activityKlitinna komponenta citoplazma ekzosoma blood microparticle mizhklitinnij prostir gialoplazma extracellular region collagen containing extracellular matrixBiologichnij proces uterine smooth muscle contraction renal system process vazokonstrikciya GO 0048554 positive regulation of catalytic activity positive regulation of cardiac muscle hypertrophy cell surface receptor signaling pathway cellular response to mechanical stimulus stress activated MAPK cascade artery smooth muscle contraction regulation of systemic arterial blood pressure by renin angiotensin regulation of apoptotic process negative regulation of neurotrophin TRK receptor signaling pathway regulation of long term neuronal synaptic plasticity positive regulation of renal sodium excretion positive regulation of fibroblast proliferation cellular sodium ion homeostasis ERK1 and ERK2 cascade activation of phospholipase C activity angiotensin maturation positive regulation of extracellular matrix constituent secretion positive regulation of blood pressure negative regulation of cell growth regulation of norepinephrine secretion zhinocha vagitnist negative regulation of tissue remodeling regulyaciya sercevogo ritmu smooth muscle cell proliferation regulation of calcium ion transport regulation of transmission of nerve impulse cell growth involved in cardiac muscle cell development response to muscle activity involved in regulation of muscle adaptation positive regulation of nitric oxide biosynthetic process angiotensin mediated drinking behavior cell cell signaling GO 0010260 starinnya lyudini vazodilataciya positive regulation of cell population proliferation fibroblast proliferation negative regulation of angiogenesis positive regulation of superoxide anion generation positive regulation of L lysine import across plasma membrane positive regulation of cardiac muscle cell apoptotic process positive regulation of vascular associated smooth muscle cell proliferation positive regulation of cytosolic calcium ion concentration negative regulation of endopeptidase activity positive regulation of vascular associated smooth muscle cell migration regulation of molecular function regulation of lipid metabolic process positive regulation of L arginine import across plasma membrane regulation of signaling receptor activity positive regulation of neuron projection development response to estradiol cellular response to angiotensin protein import into nucleus associative learning operantne obumovlennya GO 1903106 positive regulation of insulin receptor signaling pathway regulation of extracellular matrix assembly positive regulation of cholesterol esterification phospholipase C activating G protein coupled receptor signaling pathway blood vessel remodeling positive regulation of reactive oxygen species metabolic process positive regulation of extrinsic apoptotic signaling pathway GO 0051247 GO 0051200 positive regulation of protein metabolic process positive regulation of branching involved in ureteric bud morphogenesis rozvitok nirki GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of peptidyl tyrosine phosphorylation positive regulation of inflammatory response positive regulation of protein tyrosine kinase activity regulation of blood pressure positive regulation of macrophage derived foam cell differentiation regulation of vasoconstriction positive regulation of NF kappaB transcription factor activity positive regulation of NAD P H oxidase activity nitric oxide mediated signal transduction G protein coupled receptor signaling pathway coupled to cGMP nucleotide second messenger positive regulation of epidermal growth factor receptor signaling pathway regulation of blood volume by renin angiotensin regulation of cardiac conduction maintenance of blood vessel diameter homeostasis by renin angiotensin regulation of renal sodium excretion GO 0032737 positive regulation of cytokine production positive regulation of membrane hyperpolarization negative regulation of sodium ion transmembrane transporter activity renin angiotensin regulation of aldosterone production positive regulation of endothelial cell migration low density lipoprotein particle remodeling regulation of cell population proliferation regulation of cell growth positive regulation of gap junction assembly positive regulation of phosphatidylinositol 3 kinase signaling angiotensin activated signaling pathway negative regulation of gene expression regulation of renal output by angiotensin positive regulation of activation of Janus kinase activity G protein coupled receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez183 11606Ensembl ENSG00000135744 ENSMUSG00000031980UniProt P01019 P11859 Q3UTR7RefSeq mRNK NM 000029 NM 001382817 NM 001384479NM 007428RefSeq bilok NP 000020 NP 001369746NP 031454Lokus UCSC Hr 1 230 69 230 75 MbHr 8 125 28 125 3 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTAA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Cej bilok za funkciyami nalezhit do maye sudinozvuzhuyuchij efekt Regulyator arterialnogo tisku ta vodno solovogo obminu organizmu Sekretovanij nazovni Div takozhRenin angiotenzinova sistemaLiteraturaKageyama R Ohkubo H Nakanishi S 1984 Primary structure of human preangiotensinogen deduced from the cloned cDNA sequence Biochemistry 23 3603 3609 PMID 6089875 DOI 10 1021 bi00311a006 Gaillard I Clauser E Corvol P 1989 Structure of human angiotensinogen gene DNA 8 87 99 PMID 2924688 DOI 10 1089 dna 1 1989 8 87 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kunapuli S P Kumar A 1987 Molecular cloning of human angiotensinogen cDNA and evidence for the presence of its mRNA in rat heart Circ Res 60 786 790 PMID 2885106 DOI 10 1161 01 RES 60 5 786 Kunapuli S P Benedict C R Kumar A 1987 Tissue specific hormonal regulation of the rat angiotensinogen gene expression Arch Biochem Biophys 254 642 646 PMID 3579322 DOI 10 1016 0003 9861 87 90148 2 Tewksbury D A Dart R A Travis J 1981 The amino terminal amino acid sequence of human angiotensinogen Biochem Biophys Res Commun 99 1311 1315 PMID 7259779 DOI 10 1016 0006 291X 81 90762 2PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 20 travnya 2017 Procitovano 30 sichnya 2017 angl Arhiv originalu za 27 sichnya 2017 Procitovano 30 sichnya 2017 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ