IAPP (англ. Islet amyloid polypeptide) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 89 амінокислот, а молекулярна маса — 9 806.
IAPP | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | IAPP, DAP, IAP, islet amyloid polypeptide | ||||||||||||||||
Зовнішні ІД | OMIM: 147940 MGI: 96382 HomoloGene: 36024 GeneCards: IAPP | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 21.35 – 21.38 Mb | Хр. 6: 142.24 – 142.25 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MGILKLQVFL | IVLSVALNHL | KATPIESHQV | EKRKCNTATC | ATQRLANFLV | ||||
HSSNNFGAIL | SSTNVGSNTY | GKRNAVEVLK | REPLNYLPL |
Кодований геном білок за функцією належить до гормонів. Секретований назовні.
Література
- Mosselman S., Hoeppener J.W.M., Lips C.J.M., Jansz H.S. (1989). The complete islet amyloid polypeptide precursor is encoded by two exons. FEBS Lett. 247: 154—158. PMID 2651160 DOI:10.1016/0014-5793(89)81260-8
- Christmanson L., Rorsman F., Stenman G., Westermark P., Betsholtz C. (1990). The human islet amyloid polypeptide (IAPP) gene. Organization, chromosomal localization and functional identification of a promoter region. FEBS Lett. 267: 160—166. PMID 2365085 DOI:10.1016/0014-5793(90)80314-9
- Hoeppener J.W.M., Oosterwijk C., Visser-Vernooy H.J., Lips C.J.M., Jansz H.S. (1992). Characterization of the human islet amyloid polypeptide/amylin gene transcripts: identification of a new polyadenylation site. Biochem. Biophys. Res. Commun. 189: 1569—1577. PMID 1282806 DOI:10.1016/0006-291X(92)90255-J
- Bhattacharya S., Naveena Lavanya Latha J., Kumresan R., Singh S. (2007). Cloning and expression of human islet amyloid polypeptide in cultured cells. Biochem. Biophys. Res. Commun. 356: 622—628. PMID 17374526 DOI:10.1016/j.bbrc.2007.03.016
- Westermark P., Wernstedt C., Wilander E., Sletten K. (1986). A novel peptide in the calcitonin gene related peptide family as an amyloid fibril protein in the endocrine pancreas. Biochem. Biophys. Res. Commun. 140: 827—831. PMID 3535798 DOI:10.1016/0006-291X(86)90708-4
- Mascioni A., Porcelli F., Ilangovan U., Ramamoorthy A., Veglia G. (2003). Conformational preferences of the amylin nucleation site in SDS micelles: an NMR study. Biopolymers. 69: 29—41. PMID 12717720 DOI:10.1002/bip.10305
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:5329 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 14 вересня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
IAPP angl Islet amyloid polypeptide bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 89 aminokislot a molekulyarna masa 9 806 IAPPNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1KUW 2G48 2KB8 2L86 3FPO 3FR1 3FTH 3FTK 3FTL 3FTR 3G7V 3G7W 3HGZ 3DG1IdentifikatoriSimvoliIAPP DAP IAP islet amyloid polypeptideZovnishni ID OMIM 147940 MGI 96382 HomoloGene 36024 GeneCards IAPPOntologiya genaMolekulyarna funkciya signaling receptor binding hormone activity identical protein binding amyloid beta binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta extracellular region neuronal cell body mizhklitinnij prostir inclusion bodyBiologichnij proces negative regulation of cell differentiation cell cell signaling sensory perception of pain harchova povedinka GO 0072468 signalna transdukciya negative regulation of bone resorption GO 0097285 apoptoz negative regulation of cell population proliferation protein destabilization protein homooligomerization amyloid fibril formation G protein coupled receptor signaling pathway adenylate cyclase activating G protein coupled receptor signaling pathway positive regulation of cytosolic calcium ion concentration regulation of signaling receptor activity positive regulation of protein kinase A signaling negative regulation of mitochondrion organization negative regulation of protein homooligomerization positive regulation of apoptotic process positive regulation of MAPK cascade positive regulation of protein kinase B signaling amylin receptor signaling pathway negative regulation of amyloid fibril formationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3375 15874Ensembl ENSG00000121351 ENSMUSG00000041681UniProt P10997 P12968RefSeq mRNK NM 000415 NM 001329201NM 010491RefSeq bilok NP 000406 NP 001316130NP 034621Lokus UCSC Hr 12 21 35 21 38 MbHr 6 142 24 142 25 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPLA Alanin C Cisteyin E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Sekretovanij nazovni LiteraturaMosselman S Hoeppener J W M Lips C J M Jansz H S 1989 The complete islet amyloid polypeptide precursor is encoded by two exons FEBS Lett 247 154 158 PMID 2651160 DOI 10 1016 0014 5793 89 81260 8 Christmanson L Rorsman F Stenman G Westermark P Betsholtz C 1990 The human islet amyloid polypeptide IAPP gene Organization chromosomal localization and functional identification of a promoter region FEBS Lett 267 160 166 PMID 2365085 DOI 10 1016 0014 5793 90 80314 9 Hoeppener J W M Oosterwijk C Visser Vernooy H J Lips C J M Jansz H S 1992 Characterization of the human islet amyloid polypeptide amylin gene transcripts identification of a new polyadenylation site Biochem Biophys Res Commun 189 1569 1577 PMID 1282806 DOI 10 1016 0006 291X 92 90255 J Bhattacharya S Naveena Lavanya Latha J Kumresan R Singh S 2007 Cloning and expression of human islet amyloid polypeptide in cultured cells Biochem Biophys Res Commun 356 622 628 PMID 17374526 DOI 10 1016 j bbrc 2007 03 016 Westermark P Wernstedt C Wilander E Sletten K 1986 A novel peptide in the calcitonin gene related peptide family as an amyloid fibril protein in the endocrine pancreas Biochem Biophys Res Commun 140 827 831 PMID 3535798 DOI 10 1016 0006 291X 86 90708 4 Mascioni A Porcelli F Ilangovan U Ramamoorthy A Veglia G 2003 Conformational preferences of the amylin nucleation site in SDS micelles an NMR study Biopolymers 69 29 41 PMID 12717720 DOI 10 1002 bip 10305PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 5329 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 14 veresnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi