Альфа-2-HS-глікопротеїн (англ. Alpha 2-HS glycoprotein) – білок, який кодується геном AHSG, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 367 амінокислот, а молекулярна маса — 39 325.
Альфа-2-HS-глікопротеїн | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | AHSG, A2HS, AHS, FETUA, HSGA, alpha-2-HS-glycoprotein, alpha 2-HS glycoprotein | ||||||||||||||||
Зовнішні ІД | OMIM: 138680 MGI: 107189 HomoloGene: 1225 GeneCards: AHSG | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | н/д | Хр. 16: 22.71 – 22.72 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MKSLVLLLCL | AQLWGCHSAP | HGPGLIYRQP | NCDDPETEEA | ALVAIDYINQ | ||||
NLPWGYKHTL | NQIDEVKVWP | QQPSGELFEI | EIDTLETTCH | VLDPTPVARC | ||||
SVRQLKEHAV | EGDCDFQLLK | LDGKFSVVYA | KCDSSPDSAE | DVRKVCQDCP | ||||
LLAPLNDTRV | VHAAKAALAA | FNAQNNGSNF | QLEEISRAQL | VPLPPSTYVE | ||||
FTVSGTDCVA | KEATEAAKCN | LLAEKQYGFC | KATLSEKLGG | AEVAVTCTVF | ||||
QTQPVTSQPQ | PEGANEAVPT | PVVDPDAPPS | PPLGAPGLPP | AGSPPDSHVL | ||||
LAAPPGHQLH | RAHYDLRHTF | MGVVSLGSPS | GEVSHPRKTR | TVVQPSVGAA | ||||
AGPVVPPCPG | RIRHFKV |
Задіяний у такому біологічному процесі як мінеральний обмін. Секретований назовні.
Література
- Lee C.-C., Bowman B.H., Yang F. (1987). Human alpha 2-HS-glycoprotein: the A and B chains with a connecting sequence are encoded by a single mRNA transcript. Proc. Natl. Acad. Sci. U.S.A. 84: 4403—4407. PMID 3474608 DOI:10.1073/pnas.84.13.4403
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Araki T., Yoshioka Y., Schmid K. (1989). The position of the disulfide bonds in human plasma alpha 2 HS-glycoprotein and the repeating double disulfide bonds in the domain structure. Biochim. Biophys. Acta. 994: 195—199. PMID 2645941 DOI:10.1016/0167-4838(89)90293-8
- Haglund A.C., Ek B., Ek P. (2001). Phosphorylation of human plasma alpha2-Heremans-Schmid glycoprotein (human fetuin) in vivo. Biochem. J. 357: 437—445. PMID 11439093 DOI:10.1042/0264-6021:3570437
- Zhang H., Li X.-J., Martin D.B., Aebersold R. (2003). Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat. Biotechnol. 21: 660—666. PMID 12754519 DOI:10.1038/nbt827
- Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry. Proteomics. 4: 454—465. PMID 14760718 DOI:10.1002/pmic.200300556
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:349 (англ.) . Процитовано 30 січня 2017.
- (англ.) . Архів оригіналу за 15 березня 2017. Процитовано 30 січня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
Alfa 2 HS glikoproteyin angl Alpha 2 HS glycoprotein bilok yakij koduyetsya genom AHSG roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 367 aminokislot a molekulyarna masa 39 325 Alfa 2 HS glikoproteyinIdentifikatoriSimvoliAHSG A2HS AHS FETUA HSGA alpha 2 HS glycoprotein alpha 2 HS glycoproteinZovnishni ID OMIM 138680 MGI 107189 HomoloGene 1225 GeneCards AHSGOntologiya genaMolekulyarna funkciya endopeptidase inhibitor activity cysteine type endopeptidase inhibitor activity kinase inhibitor activityKlitinna komponenta blood microparticle ekzosoma platelet alpha granule lumen mizhklitinnij prostir kompleks Goldzhi secretory granule lumen endoplasmic reticulum lumen GO 0005578 Pozaklitinna matricya extracellular region collagen containing extracellular matrixBiologichnij proces regulation of bone mineralization negative regulation of biomineral tissue development skeletal system development GO 1903105 negative regulation of insulin receptor signaling pathway positive regulation of phagocytosis Pinocitoz negative regulation of bone mineralization acute phase response osifikaciya regulation of inflammatory response negative regulation of phosphorylation platelet degranulation negative regulation of endopeptidase activity neutrophil degranulation posttranslyacijna modifikaciya negative regulation of kinase activityDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez197 11625Ensembl ENSG00000145192 ENSMUSG00000022868UniProt P02765 P29699RefSeq mRNK NM 001622NM 001276449 NM 001276450 NM 013465RefSeq bilok NP 001613 NP 001341500 NP 001341501 NP 001341502NP 001263378 NP 001263379 NP 038493Lokus UCSC n dHr 16 22 71 22 72 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQ NLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARC SVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCP LLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVE FTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVF QTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL LAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAA AGPVVPPCPGRIRHFKV A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak mineralnij obmin Sekretovanij nazovni LiteraturaLee C C Bowman B H Yang F 1987 Human alpha 2 HS glycoprotein the A and B chains with a connecting sequence are encoded by a single mRNA transcript Proc Natl Acad Sci U S A 84 4403 4407 PMID 3474608 DOI 10 1073 pnas 84 13 4403 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Araki T Yoshioka Y Schmid K 1989 The position of the disulfide bonds in human plasma alpha 2 HS glycoprotein and the repeating double disulfide bonds in the domain structure Biochim Biophys Acta 994 195 199 PMID 2645941 DOI 10 1016 0167 4838 89 90293 8 Haglund A C Ek B Ek P 2001 Phosphorylation of human plasma alpha2 Heremans Schmid glycoprotein human fetuin in vivo Biochem J 357 437 445 PMID 11439093 DOI 10 1042 0264 6021 3570437 Zhang H Li X J Martin D B Aebersold R 2003 Identification and quantification of N linked glycoproteins using hydrazide chemistry stable isotope labeling and mass spectrometry Nat Biotechnol 21 660 666 PMID 12754519 DOI 10 1038 nbt827 Bunkenborg J Pilch B J Podtelejnikov A V Wisniewski J R 2004 Screening for N glycosylated proteins by liquid chromatography mass spectrometry Proteomics 4 454 465 PMID 14760718 DOI 10 1002 pmic 200300556PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 349 angl Procitovano 30 sichnya 2017 angl Arhiv originalu za 15 bereznya 2017 Procitovano 30 sichnya 2017 Div takozhHromosoma 3 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi