Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

ADIPOQ англ Adiponectin C1Q and collagen domain containing білок який кодується однойменним геном розташованим у людей н

Адипонектин

Адипонектин

ADIPOQ (англ. Adiponectin, C1Q and collagen domain containing) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. Довжина поліпептидного ланцюга білка становить 244 амінокислот, а молекулярна маса — 26 414.

ADIPOQ
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ADIPOQ, ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28, adiponectin, C1Q and collagen domain containing, Adiponectin
Зовнішні ІД OMIM: 605441 MGI: 106675 HomoloGene: 3525 GeneCards: ADIPOQ
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
9370
11450
Ensembl
ENSG00000181092
ENSMUSG00000022878
UniProt
Q15848
Q60994
RefSeq (мРНК)
NM_001177800
NM_004797
NM_009605
RefSeq (білок)
NP_001171271
NP_004788
NP_033735
Локус (UCSC) Хр. 3: 186.84 – 186.86 Mb Хр. 16: 22.97 – 22.98 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHN
GAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGR
KGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKF
HCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGS
VLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Кодований геном білок за функцією належить до гормонів. Задіяний у такому біологічному процесі як поліморфізм. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504
  • Nakano Y., Tobe T., Choi-Miura N.H., Mazda T., Tomita M. (1996). Isolation and characterization of GBP28, a novel gelatin-binding protein purified from human plasma. J. Biochem. 120: 803—812. PMID 8947845 DOI:10.1093/oxfordjournals.jbchem.a021483

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 26 березня 2016. Процитовано 30 серпня 2017.
  4. (англ.) . Архів оригіналу за 17 серпня 2017. Процитовано 30 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

ADIPOQ angl Adiponectin C1Q and collagen domain containing bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 3 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 244 aminokislot a molekulyarna masa 26 414 ADIPOQNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB4DOUIdentifikatoriSimvoliADIPOQ ACDC ACRP30 ADIPQTL1 ADPN APM 1 APM1 GBP28 adiponectin C1Q and collagen domain containing AdiponectinZovnishni ID OMIM 605441 MGI 106675 HomoloGene 3525 GeneCards ADIPOQOntologiya genaMolekulyarna funkciya hormone activity signaling receptor binding cytokine activity sialic acid binding protein homodimerization activity GO 0001948 GO 0016582 protein binding identical protein binding extracellular matrix structural constituentKlitinna komponenta cell surface endoplazmatichnij retikulum kolagen mizhklitinnij prostir extracellular region GO 0009327 protein containing complex collagen containing extracellular matrixBiologichnij proces positive regulation of glucose import positive regulation of protein phosphorylation negative regulation of receptor binding low density lipoprotein particle clearance negative regulation of blood pressure negative regulation of macrophage differentiation negative regulation of synaptic transmission generation of precursor metabolites and energy cellular response to epinephrine stimulus negative regulation of gluconeogenesis regulation of glucose metabolic process cirkadnij ritm fatty acid oxidation positive regulation of interleukin 8 production glucose metabolic process protein heterotrimerization negative regulation of heterotypic cell cell adhesion response to ethanol negative regulation of inflammatory response cellular response to cAMP positive regulation of protein kinase A signaling negative regulation of platelet derived growth factor receptor signaling pathway positive regulation of signal transduction GO 0051247 GO 0051200 positive regulation of protein metabolic process negative regulation of fat cell differentiation response to linoleic acid detection of oxidative stress glucose homeostasis adiponectin activated signaling pathway response to tumor necrosis factor positive regulation of blood pressure response to nutrient levels positive regulation of cholesterol efflux negative regulation of MAP kinase activity cellular response to insulin stimulus positive regulation of peptidyl tyrosine phosphorylation fatty acid beta oxidation negative regulation of tumor necrosis factor production protein localization to plasma membrane negative regulation of hormone secretion protein homooligomerization response to sucrose positive regulation of metanephric glomerular visceral epithelial cell development positive regulation of renal albumin absorption negative regulation of granulocyte differentiation response to nutrient negative regulation of protein autophosphorylation negative regulation of intracellular protein transport membrane depolarization response to glucose positive regulation of myeloid cell apoptotic process negative regulation of I kappaB kinase NF kappaB signaling negative regulation of metanephric mesenchymal cell migration negative regulation of cell migration positive regulation of fatty acid metabolic process brown fat cell differentiation positive regulation of cAMP dependent protein kinase activity positive regulation of glycogen starch synthase activity GO 0045996 negative regulation of transcription DNA templated negative regulation of DNA biosynthetic process positive regulation of protein kinase activity response to hypoxia negative regulation of phagocytosis membrane hyperpolarization negative regulation of tumor necrosis factor mediated signaling pathway positive regulation of monocyte chemotactic protein 1 production response to glucocorticoid response to activity negative regulation of platelet derived growth factor receptor alpha signaling pathway positive regulation of I kappaB kinase NF kappaB signaling negative regulation of ERK1 and ERK2 cascade negative regulation of macrophage derived foam cell differentiation regulation of fatty acid biosynthetic process regulation of signaling receptor activity negative regulation of vascular associated smooth muscle cell proliferation negative regulation of vascular associated smooth muscle cell migration response to bacterium positive regulation of cold induced thermogenesis negative regulation of cold induced thermogenesis GO 0072468 signalna transdukciyaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez9370 11450Ensembl ENSG00000181092 ENSMUSG00000022878UniProt Q15848 Q60994RefSeq mRNK NM 001177800 NM 004797NM 009605RefSeq bilok NP 001171271 NP 004788NP 033735Lokus UCSC Hr 3 186 84 186 86 MbHr 16 22 97 22 98 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Zadiyanij u takomu biologichnomu procesi yak polimorfizm Sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504 Nakano Y Tobe T Choi Miura N H Mazda T Tomita M 1996 Isolation and characterization of GBP28 a novel gelatin binding protein purified from human plasma J Biochem 120 803 812 PMID 8947845 DOI 10 1093 oxfordjournals jbchem a021483PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 26 bereznya 2016 Procitovano 30 serpnya 2017 angl Arhiv originalu za 17 serpnya 2017 Procitovano 30 serpnya 2017 Div takozhHromosoma 3Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ