PPBP (англ. Pro-platelet basic protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. Довжина поліпептидного ланцюга білка становить 128 амінокислот, а молекулярна маса — 13 894.
PPBP | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | PPBP, B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1, pro-platelet basic protein | ||||||||||||||||
Зовнішні ІД | OMIM: 121010 MGI: 1888712 HomoloGene: 136759 GeneCards: PPBP | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 4: 73.99 – 73.99 Mb | Хр. 5: 90.92 – 90.92 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MSLRLDTTPS | CNSARPLHAL | QVLLLLSLLL | TALASSTKGQ | TKRNLAKGKE | ||||
ESLDSDLYAE | LRCMCIKTTS | GIHPKNIQSL | EVIGKGTHCN | QVEVIATLKD | ||||
GRKICLDPDA | PRIKKIVQKK | LAGDESAD |
Кодований геном білок за функціями належить до цитокінів, факторів росту, антибіотиків, , мітогенів. Задіяний у такому біологічному процесі як хемотаксис. Секретований назовні.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 13: 2819—2824. PMID 15340161 DOI:10.1110/ps.04682504
- Castor C.W., Miller J.W., Walz D.A. (1983). Structural and biological characteristics of connective tissue activating peptide (CTAP-III), a major human platelet-derived growth factor. Proc. Natl. Acad. Sci. U.S.A. 80: 765—769. PMID 6572368 DOI:10.1073/pnas.80.3.765
- Begg G.S., Pepper D.S., Chesterman C.N., Morgan F.J. (1978). Complete covalent structure of human beta-thromboglobulin. Biochemistry. 17: 1739—1744. PMID 77677 DOI:10.1021/bi00602a024
- Walz A., Baggiolini M. (1989). A novel cleavage product of beta-thromboglobulin formed in cultures of stimulated mononuclear cells activates human neutrophils. Biochem. Biophys. Res. Commun. 159: 969—975. PMID 2522778 DOI:10.1016/0006-291X(89)92203-1
- Walz A., Baggiolini M. (1990). Generation of the neutrophil-activating peptide NAP-2 from platelet basic protein or connective tissue-activating peptide III through monocyte proteases. J. Exp. Med. 171: 449—454. PMID 2406364 DOI:10.1084/jem.171.2.449
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:9240 (англ.) . Процитовано 6 лютого 2017.
- (англ.) . Архів оригіналу за 2 березня 2017. Процитовано 6 лютого 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
PPBP angl Pro platelet basic protein bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 4 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 128 aminokislot a molekulyarna masa 13 894 PPBPNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1TVX 1F9P 1NAPIdentifikatoriSimvoliPPBP B TG1 Beta TG CTAP III CTAP3 CTAPIII CXCL7 LA PF4 LDGF MDGF NAP 2 PBP SCYB7 TC1 TC2 TGB TGB1 THBGB THBGB1 pro platelet basic proteinZovnishni ID OMIM 121010 MGI 1888712 HomoloGene 136759 GeneCards PPBPOntologiya genaMolekulyarna funkciya growth factor activity cytokine activity glucose transmembrane transporter activity CXCR chemokine receptor binding chemokine activity GO 0001948 GO 0016582 protein bindingKlitinna komponenta platelet alpha granule lumen extracellular region mizhklitinnij prostir tertiary granule lumen platelet alpha granuleBiologichnij proces response to lipopolysaccharide regulation of cell population proliferation hemotaksis positive regulation of cell division platelet degranulation defense response to bacterium inflammatory response GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid chemokine mediated signaling pathway defense response positive regulation of neutrophil chemotaxis antimicrobial humoral immune response mediated by antimicrobial peptide regulation of signaling receptor activity neutrophil degranulation cell chemotaxis G protein coupled receptor signaling pathway glucose transmembrane transport neutrophil chemotaxis leukocyte chemotaxis cellular response to lipopolysaccharideDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5473 57349Ensembl ENSG00000163736 ENSMUSG00000029372UniProt P02775 Q9EQI5RefSeq mRNK NM 002704NM 023785RefSeq bilok NP 002695NP 076274Lokus UCSC Hr 4 73 99 73 99 MbHr 5 90 92 90 92 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKE ESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKD GRKICLDPDAPRIKKIVQKKLAGDESAD A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do citokiniv faktoriv rostu antibiotikiv mitogeniv Zadiyanij u takomu biologichnomu procesi yak hemotaksis Sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Zhang Z Henzel W J 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites Protein Sci 13 2819 2824 PMID 15340161 DOI 10 1110 ps 04682504 Castor C W Miller J W Walz D A 1983 Structural and biological characteristics of connective tissue activating peptide CTAP III a major human platelet derived growth factor Proc Natl Acad Sci U S A 80 765 769 PMID 6572368 DOI 10 1073 pnas 80 3 765 Begg G S Pepper D S Chesterman C N Morgan F J 1978 Complete covalent structure of human beta thromboglobulin Biochemistry 17 1739 1744 PMID 77677 DOI 10 1021 bi00602a024 Walz A Baggiolini M 1989 A novel cleavage product of beta thromboglobulin formed in cultures of stimulated mononuclear cells activates human neutrophils Biochem Biophys Res Commun 159 969 975 PMID 2522778 DOI 10 1016 0006 291X 89 92203 1 Walz A Baggiolini M 1990 Generation of the neutrophil activating peptide NAP 2 from platelet basic protein or connective tissue activating peptide III through monocyte proteases J Exp Med 171 449 454 PMID 2406364 DOI 10 1084 jem 171 2 449PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9240 angl Procitovano 6 lyutogo 2017 angl Arhiv originalu za 2 bereznya 2017 Procitovano 6 lyutogo 2017 Div takozhHromosoma 4 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi