LHB (англ. Luteinizing hormone beta polypeptide) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 141 амінокислот, а молекулярна маса — 15 345.
LHB | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | LHB, CGB4, LSH-B, hHH23, Luteinizing hormone beta polypeptide, LSH-beta, Luteinizing hormone subunit beta | ||||||||||||||||
Зовнішні ІД | OMIM: 152780 MGI: 96782 HomoloGene: 81806 GeneCards: LHB | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
hypogonadotropic hypogonadism 23 with or without anosmia | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 49.02 – 49.02 Mb | н/д | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MEMLQGLLLL | LLLSMGGAWA | SREPLRPWCH | PINAILAVEK | EGCPVCITVN | ||||
TTICAGYCPT | MMRVLQAVLP | PLPQVVCTYR | DVRFESIRLP | GCPRGVDPVV | ||||
SFPVALSCRC | GPCRRSTSDC | GGPKDHPLTC | DHPQLSGLLF | L |
Кодований геном білок за функцією належить до гормонів. Секретований назовні.
Література
- Talmadge K., Vamvakopoulos N.C., Fiddes J.C. (1984). Evolution of the genes for the beta subunits of human chorionic gonadotropin and luteinizing hormone. Nature. 307: 37—40. PMID 6690982 DOI:10.1038/307037a0
- Shome B., Parlow A.F. (1973). The primary structure of the hormone-specific, beta subunit of human pituitary luteinizing hormone (hLH). J. Clin. Endocrinol. Metab. 36: 618—621. PMID 4685398 DOI:10.1210/jcem-36-3-618
- Closset J., Hennen G., Lequin R.M. (1973). Human luteinizing hormone. The amino acid sequence of the subunit. FEBS Lett. 29: 97—100. PMID 4719207 DOI:10.1016/0014-5793(73)80534-4
- Weisshaar G., Hiyama J., Renwick A.G.C., Nimtz M. (1991). NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. Eur. J. Biochem. 195: 257—268. PMID 1991473 DOI:10.1111/j.1432-1033.1991.tb15702.x
- Keutmann H.T., Hua Q.-X., Weiss M.A. (1992). Structure of a receptor-binding fragment from human luteinizing hormone beta-subunit determined by [1H]- and [15N]nuclear magnetic resonance spectroscopy. Mol. Endocrinol. 6: 904—913. PMID 1495492 DOI:10.1210/mend.6.6.1495492
- Liao W.X., Roy A.C., Chan C., Arulkumaran S., Ratnam S.S. (1998). A new molecular variant of luteinizing hormone associated with female infertility. Fertil. Steril. 69: 102—106. PMID 9457942 DOI:10.1016/S0015-0282(97)00445-7
Примітки
- Захворювання, генетично пов'язані з LHB переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:6584 (англ.) . Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
LHB angl Luteinizing hormone beta polypeptide bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 141 aminokislot a molekulyarna masa 15 345 LHBNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1M92IdentifikatoriSimvoliLHB CGB4 LSH B hHH23 Luteinizing hormone beta polypeptide LSH beta Luteinizing hormone subunit betaZovnishni ID OMIM 152780 MGI 96782 HomoloGene 81806 GeneCards LHBPov yazani genetichni zahvoryuvannyahypogonadotropic hypogonadism 23 with or without anosmia Ontologiya genaMolekulyarna funkciya signaling receptor binding hormone activityKlitinna komponenta Golgi lumen extracellular region mizhklitinnij prostir citoplazmaBiologichnij proces cell cell signaling progesterone biosynthetic process male gonad development peptide hormone processing GO 0072468 signalna transdukciya hormone mediated signaling pathway ovulyaciya regulation of signaling receptor activity G protein coupled receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez3972 16866Ensembl ENSG00000104826 ENSMUSG00000100916UniProt P01229 O09108RefSeq mRNK NM 000894NM 008497RefSeq bilok NP 000885NP 032523Lokus UCSC Hr 19 49 02 49 02 Mbn dPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVN TTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVV SFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do gormoniv Sekretovanij nazovni LiteraturaTalmadge K Vamvakopoulos N C Fiddes J C 1984 Evolution of the genes for the beta subunits of human chorionic gonadotropin and luteinizing hormone Nature 307 37 40 PMID 6690982 DOI 10 1038 307037a0 Shome B Parlow A F 1973 The primary structure of the hormone specific beta subunit of human pituitary luteinizing hormone hLH J Clin Endocrinol Metab 36 618 621 PMID 4685398 DOI 10 1210 jcem 36 3 618 Closset J Hennen G Lequin R M 1973 Human luteinizing hormone The amino acid sequence of the subunit FEBS Lett 29 97 100 PMID 4719207 DOI 10 1016 0014 5793 73 80534 4 Weisshaar G Hiyama J Renwick A G C Nimtz M 1991 NMR investigations of the N linked oligosaccharides at individual glycosylation sites of human lutropin Eur J Biochem 195 257 268 PMID 1991473 DOI 10 1111 j 1432 1033 1991 tb15702 x Keutmann H T Hua Q X Weiss M A 1992 Structure of a receptor binding fragment from human luteinizing hormone beta subunit determined by 1H and 15N nuclear magnetic resonance spectroscopy Mol Endocrinol 6 904 913 PMID 1495492 DOI 10 1210 mend 6 6 1495492 Liao W X Roy A C Chan C Arulkumaran S Ratnam S S 1998 A new molecular variant of luteinizing hormone associated with female infertility Fertil Steril 69 102 106 PMID 9457942 DOI 10 1016 S0015 0282 97 00445 7PrimitkiZahvoryuvannya genetichno pov yazani z LHB pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6584 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 23 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi