Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

HEY2 англ Hes related family bHLH transcription factor with YRPW motif 2 білок який кодується однойменним геном розташов

HEY2

HEY2

HEY2 (англ. Hes related family bHLH transcription factor with YRPW motif 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 337 амінокислот, а молекулярна маса — 35 808.

HEY2
Ідентифікатори
Символи HEY2, CHF1, GRIDLOCK, GRL, HERP1, HESR2, HRT2, bHLHb32, hes related family bHLH transcription factor with YRPW motif 2
Зовнішні ІД OMIM: 604674 MGI: 1341884 HomoloGene: 22705 GeneCards: HEY2
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
23493
15214
Ensembl
ENSG00000135547
ENSMUSG00000019789
UniProt
Q9UBP5
Q5TF93
Q9QUS4
RefSeq (мРНК)
NM_012259
NM_013904
RefSeq (білок)
NP_036391
NP_038932
Локус (UCSC) Хр. 6: 125.75 – 125.76 Mb Хр. 10: 30.71 – 30.72 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARK
KRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHL
KMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLR
VRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPN
GLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCV
PPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF

Кодований геном білок за функціями належить до репресорів, . Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література

  • Leimeister C., Externbrinck A., Klamt B., Gessler M. (1999). Hey genes: a novel subfamily of hairy- and enhancer of split related genes specifically expressed during mouse embryogenesis. Mech. Dev. 85: 173—177. PMID 10415358 DOI:10.1016/S0925-4773(99)00080-5
  • Zhong T.P., Rosenberg M., Mohideen M.-A.P.K., Weinstein B., Fishman M.C. (2000). Gridlock, an HLH gene required for assembly of the aorta in zebrafish. Science. 287: 1820—1824. PMID 10710309 DOI:10.1126/science.287.5459.1820
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Shirvani S., Xiang F., Koibuchi N., Chin M.T. (2006). CHF1/Hey2 suppresses SM-MHC promoter activity through an interaction with GATA-6. Biochem. Biophys. Res. Commun. 339: 151—156. PMID 16293227 DOI:10.1016/j.bbrc.2005.10.190
  • Reamon-Buettner S.M., Borlak J. (2006). HEY2 mutations in malformed hearts. Hum. Mutat. 27: 118—118. PMID 16329098 DOI:10.1002/humu.9390

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:4881 (англ.) . Процитовано 6 вересня 2017.
  4. (англ.) . Архів оригіналу за 15 липня 2017. Процитовано 6 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

HEY2 angl Hes related family bHLH transcription factor with YRPW motif 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 337 aminokislot a molekulyarna masa 35 808 HEY2IdentifikatoriSimvoliHEY2 CHF1 GRIDLOCK GRL HERP1 HESR2 HRT2 bHLHb32 hes related family bHLH transcription factor with YRPW motif 2Zovnishni ID OMIM 604674 MGI 1341884 HomoloGene 22705 GeneCards HEY2Ontologiya genaMolekulyarna funkciya microsatellite binding sequence specific DNA binding DNA binding protein dimerization activity protein homodimerization activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity transcription factor binding histone deacetylase binding GO 0000983 RNA polymerase II general transcription initiation factor activity GO 0001948 GO 0016582 protein binding protein heterodimerization activity GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific RNA polymerase II transcription regulatory region sequence specific DNA binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific GO 0001106 transcription corepressor activity sequence specific double stranded DNA bindingKlitinna komponenta citoplazma transcription repressor complex Sin3 complex nukleoplazma klitinne yadroBiologichnij proces dorsal aorta morphogenesis cardiac vascular smooth muscle cell development cochlea development pattern specification process cell fate commitment pulmonary valve morphogenesis regulation of inner ear auditory receptor cell differentiation negative regulation of transcription from RNA polymerase II promoter involved in smooth muscle cell differentiation GO 0009373 regulation of transcription DNA templated heart trabecula formation tricuspid valve morphogenesis regulation of vasculogenesis pulmonary artery morphogenesis cardiac septum morphogenesis negative regulation of cardiac vascular smooth muscle cell differentiation muscular septum morphogenesis ventricular septum morphogenesis protein DNA complex assembly cardiac muscle hypertrophy outflow tract morphogenesis ascending aorta morphogenesis cardiac left ventricle morphogenesis labyrinthine layer blood vessel development GO 1901227 negative regulation of transcription by RNA polymerase II coronary vasculature morphogenesis smooth muscle cell differentiation negative regulation of gene expression endocardial cushion to mesenchymal transition involved in heart valve formation transcription DNA templated ventricular trabecula myocardium morphogenesis positive regulation of heart rate vaskulogenez multicellular organism development atrial septum morphogenesis negative regulation of cardiac muscle cell apoptotic process heart development arterial endothelial cell differentiation positive regulation of cardiac muscle cell proliferation blood vessel development cardiac muscle hypertrophy in response to stress umbilical cord morphogenesis negative regulation of transcription regulatory region DNA binding mesenchymal cell development artery development regulyaciya ekspresiyi geniv negative regulation of transcription by transcription factor localization negative regulation of transcription initiation from RNA polymerase II promoter vascular associated smooth muscle cell development anterior posterior axis specification tricuspid valve formation GO 0045996 negative regulation of transcription DNA templated cardiac ventricle morphogenesis cardiac right ventricle morphogenesis ventricular cardiac muscle cell development atrioventricular valve development GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of Notch signaling pathway cardiac epithelial to mesenchymal transition Notch signaling involved in heart development Signalnij shlyah Notch GO 0060469 GO 0009371 positive regulation of transcription DNA templated diferenciaciya klitin regulation of neurogenesis aortic valve morphogenesis epithelial to mesenchymal transition involved in endocardial cushion formation GO 1901313 positive regulation of gene expression negative regulation of biomineral tissue development anterior posterior pattern specification circulatory system developmentDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez23493 15214Ensembl ENSG00000135547 ENSMUSG00000019789UniProt Q9UBP5 Q5TF93 Q9QUS4RefSeq mRNK NM 012259NM 013904RefSeq bilok NP 036391NP 038932Lokus UCSC Hr 6 125 75 125 76 MbHr 10 30 71 30 72 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARK KRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHL KMLQATGGKGYFDAHALAMDFMSIGFRECLTEVARYLSSVEGLDSSDPLR VRLVSHLSTCATQREAAAMTSSMAHHHHPLHPHHWAAAFHHLPAALLQPN GLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRMPSTGSVAPCV PPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u yadri LiteraturaLeimeister C Externbrinck A Klamt B Gessler M 1999 Hey genes a novel subfamily of hairy and enhancer of split related genes specifically expressed during mouse embryogenesis Mech Dev 85 173 177 PMID 10415358 DOI 10 1016 S0925 4773 99 00080 5 Zhong T P Rosenberg M Mohideen M A P K Weinstein B Fishman M C 2000 Gridlock an HLH gene required for assembly of the aorta in zebrafish Science 287 1820 1824 PMID 10710309 DOI 10 1126 science 287 5459 1820 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Shirvani S Xiang F Koibuchi N Chin M T 2006 CHF1 Hey2 suppresses SM MHC promoter activity through an interaction with GATA 6 Biochem Biophys Res Commun 339 151 156 PMID 16293227 DOI 10 1016 j bbrc 2005 10 190 Reamon Buettner S M Borlak J 2006 HEY2 mutations in malformed hearts Hum Mutat 27 118 118 PMID 16329098 DOI 10 1002 humu 9390PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 4881 angl Procitovano 6 veresnya 2017 angl Arhiv originalu za 15 lipnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ