Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

NEUROD1 англ Neuronal differentiation 1 білок який кодується однойменним геном розташованим у людей на короткому плечі 2

NEUROD1

NEUROD1

NEUROD1 (англ. Neuronal differentiation 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. Довжина поліпептидного ланцюга білка становить 356 амінокислот, а молекулярна маса — 39 920.

NEUROD1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NEUROD1, BETA2, BHF-1, MODY6, NEUROD, bHLHa3, neuronal differentiation 1, T2D
Зовнішні ІД OMIM: 601724 MGI: 1339708 HomoloGene: 1871 GeneCards: NEUROD1
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
4760
18012
Ensembl
ENSG00000162992
ENSMUSG00000034701
UniProt
Q13562
Q60867
RefSeq (мРНК)
NM_002500
NM_010894
RefSeq (білок)
NP_002491
NP_035024
Локус (UCSC) Хр. 2: 181.67 – 181.68 Mb Хр. 2: 79.28 – 79.29 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEE
DSLRNGGEEEDEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFK
LRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYI
WALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQN
QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYS
AALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
MHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL
NAIFHD

Кодований геном білок за функціями належить до активаторів, , фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, диференціація, нейрогенез, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література

  • Miyachi T., Maruyama H., Kitamura T., Nakamura S., Kawakami H. (1999). Structure and regulation of the human NeuroD (BETA2/BHF1) gene. Brain Res. Mol. Brain Res. 69: 223—231. PMID 10366743 DOI:10.1016/S0169-328X(99)00112-6
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Acharya H.R., Dooley C.M., Thoreson W.B., Ahmad I. (1997). cDNA cloning and expression analysis of NeuroD mRNA in human retina. Biochem. Biophys. Res. Commun. 233: 459—463. PMID 9144558 DOI:10.1006/bbrc.1997.6483
  • Ray S.K., Nishitani J., Petry M.W., Fessing M.Y., Leiter A.B. (2003). Novel transcriptional potentiation of BETA2/NeuroD on the secretin gene promoter by the DNA-binding protein Finb/RREB-1. Mol. Cell. Biol. 23: 259—271. PMID 12482979 DOI:10.1128/MCB.23.1.259-271.2003

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. (англ.) . Архів оригіналу за 7 листопада 2016. Процитовано 28 серпня 2017.
  4. (англ.) . Архів оригіналу за 25 лютого 2018. Процитовано 28 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

NEUROD1 angl Neuronal differentiation 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 2 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 356 aminokislot a molekulyarna masa 39 920 NEUROD1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2QL2IdentifikatoriSimvoliNEUROD1 BETA2 BHF 1 MODY6 NEUROD bHLHa3 neuronal differentiation 1 T2DZovnishni ID OMIM 601724 MGI 1339708 HomoloGene 1871 GeneCards NEUROD1Ontologiya genaMolekulyarna funkciya sequence specific DNA binding GO 0001105 transcription coactivator activity DNA binding protein dimerization activity GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specific transcription factor binding chromatin binding GO 0000980 RNA polymerase II cis regulatory region sequence specific DNA binding E box binding GO 0001948 GO 0016582 protein binding protein heterodimerization activity double stranded DNA binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specificKlitinna komponenta citoplazma vnutrishnoklitinnij nukleoplazma RNA polymerase II transcription regulator complex klitinne yadroBiologichnij proces positive regulation of transcription regulatory region DNA binding regulation of neuron differentiation Nejrogenez diferenciaciya klitin cell fate commitment GO 0009373 regulation of transcription DNA templated pancreatic PP cell fate commitment glucose homeostasis regulation of insulin secretion enteroendocrine cell differentiation dentate gyrus development signal transduction involved in regulation of gene expression neuron development insulin secretion positive regulation of DNA binding transcription factor activity response to glucose transcription by RNA polymerase II embryonic organ morphogenesis cerebellum development transcription DNA templated nejrobiologiya rozvitku GO 0060469 GO 0009371 positive regulation of transcription DNA templated multicellular organism development hindbrain development nucleocytoplasmic transport positive regulation of neuron differentiation positive regulation of cell differentiation nitric oxide mediated signal transduction positive regulation of apoptotic process regulation of intestinal epithelial structure maintenance inner ear development camera type eye development pancreatic A cell fate commitment amacrine cell differentiation negative regulation of type B pancreatic cell apoptotic process cellular response to glucose stimulus anterior posterior pattern specification endocrine pancreas development GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of receptor signaling pathway via JAK STATDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez4760 18012Ensembl ENSG00000162992 ENSMUSG00000034701UniProt Q13562 Q60867RefSeq mRNK NM 002500NM 010894RefSeq bilok NP 002491NP 035024Lokus UCSC Hr 2 181 67 181 68 MbHr 2 79 28 79 29 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEE DSLRNGGEEEDEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFK LRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYI WALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQN QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYS AALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT MHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL NAIFHD A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do aktivatoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi diferenciaciya nejrogenez polimorfizm Bilok maye sajt dlya zv yazuvannya z DNK Lokalizovanij u citoplazmi yadri LiteraturaMiyachi T Maruyama H Kitamura T Nakamura S Kawakami H 1999 Structure and regulation of the human NeuroD BETA2 BHF1 gene Brain Res Mol Brain Res 69 223 231 PMID 10366743 DOI 10 1016 S0169 328X 99 00112 6 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Acharya H R Dooley C M Thoreson W B Ahmad I 1997 cDNA cloning and expression analysis of NeuroD mRNA in human retina Biochem Biophys Res Commun 233 459 463 PMID 9144558 DOI 10 1006 bbrc 1997 6483 Ray S K Nishitani J Petry M W Fessing M Y Leiter A B 2003 Novel transcriptional potentiation of BETA2 NeuroD on the secretin gene promoter by the DNA binding protein Finb RREB 1 Mol Cell Biol 23 259 271 PMID 12482979 DOI 10 1128 MCB 23 1 259 271 2003PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 7 listopada 2016 Procitovano 28 serpnya 2017 angl Arhiv originalu za 25 lyutogo 2018 Procitovano 28 serpnya 2017 Div takozhHromosoma 2 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ