CBX5 (англ. Chromobox 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми. Довжина поліпептидного ланцюга білка становить 191 амінокислот, а молекулярна маса — 22 225.
CBX5 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | CBX5, HEL25, HP1, HP1A, chromobox 5 | ||||||||||||||||
Зовнішні ІД | OMIM: 604478 MGI: 109372 HomoloGene: 7257 GeneCards: CBX5 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 12: 54.23 – 54.28 Mb | Хр. 15: 103.1 – 103.15 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MGKKTKRTAD | SSSSEDEEEY | VVEKVLDRRV | VKGQVEYLLK | WKGFSEEHNT | ||||
WEPEKNLDCP | ELISEFMKKY | KKMKEGENNK | PREKSESNKR | KSNFSNSADD | ||||
IKSKKKREQS | NDIARGFERG | LEPEKIIGAT | DSCGDLMFLM | KWKDTDEADL | ||||
VLAKEANVKC | PQIVIAFYEE | RLTWHAYPED | AENKEKETAK | S |
Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, ацетилювання. Локалізований у ядрі, хромосомах, центромерах.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Ye Q., Worman H.J. (1996). Interaction between an integral protein of the nuclear envelope inner membrane and human chromodomain proteins homologous to Drosophila HP1. J. Biol. Chem. 271: 14653—14656. PMID 8663349 DOI:10.1074/jbc.271.25.14653
- Ye Q., Callebaut I., Pezhman A., Courvalin J.-C., Worman H.J. (1997). Domain-specific interactions of human HP1-type chromodomain proteins and inner nuclear membrane protein LBR. J. Biol. Chem. 272: 14983—14989. PMID 9169472 DOI:10.1074/jbc.272.23.14983
- Minc E., Allory Y., Worman H.J., Courvalin J.-C., Buendia B. (1999). Localization and phosphorylation of HP1 proteins during the cell cycle in mammalian cells. Chromosoma. 108: 220—234. PMID 10460410 DOI:10.1007/s004120050372
- Lachner M., O'Carroll D., Rea S., Mechtler K., Jenuwein T. (2001). Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins. Nature. 410: 116—120. PMID 11242053 DOI:10.1038/35065132
- Lechner M.S., Schultz D.C., Negorev D., Maul G.G., Rauscher F.J. III (2005). The mammalian heterochromatin protein 1 binds diverse nuclear proteins through a common motif that targets the chromoshadow domain. Biochem. Biophys. Res. Commun. 331: 929—937. PMID 15882967 DOI:10.1016/j.bbrc.2005.04.016
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:1555 (англ.) . Процитовано 11 вересня 2017.
- (англ.) . Архів оригіналу за 30 серпня 2017. Процитовано 11 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CBX5 angl Chromobox 5 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 12 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 191 aminokislot a molekulyarna masa 22 225 CBX5Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3FDT 3I3CIdentifikatoriSimvoliCBX5 HEL25 HP1 HP1A chromobox 5Zovnishni ID OMIM 604478 MGI 109372 HomoloGene 7257 GeneCards CBX5Ontologiya genaMolekulyarna funkciya protein homodimerization activity GO 0001948 GO 0016582 protein binding protein macromolecule adaptor activity chromatin binding histone deacetylase binding methylated histone binding ribonucleoprotein complex binding GO 0032403 protein containing complex binding identical protein bindingKlitinna komponenta kinetohor klitinne yadro nuclear envelope pericentric heterochromatin yaderce histone deacetylase complex nukleoplazma chromocenter GO 0035328 Geterohromatin centromera histone methyltransferase complex transcription repressor complex hromosoma PML body GO 0009327 protein containing complex Ribonukleoproteyini site of DNA damageBiologichnij proces zsidannya krovi GO 0045996 negative regulation of transcription DNA templated GO 0022415 viral process GO 1901227 negative regulation of transcription by RNA polymerase II negative regulation of G0 to G1 transition cellular response to DNA damage stimulusDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez23468 12419Ensembl ENSG00000094916 ENSMUSG00000009575UniProt P45973 Q61686RefSeq mRNK NM 012117 NM 001127321 NM 001127322NM 001076789 NM 001110216 NM 007626 NM 001358950RefSeq bilok NP 001120793 NP 001120794 NP 036249NP 001070257 NP 001103686 NP 031652 NP 001345879Lokus UCSC Hr 12 54 23 54 28 MbHr 15 103 1 103 15 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNT WEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD IKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADL VLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak vzayemodiya hazyayin virus acetilyuvannya Lokalizovanij u yadri hromosomah centromerah LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Ye Q Worman H J 1996 Interaction between an integral protein of the nuclear envelope inner membrane and human chromodomain proteins homologous to Drosophila HP1 J Biol Chem 271 14653 14656 PMID 8663349 DOI 10 1074 jbc 271 25 14653 Ye Q Callebaut I Pezhman A Courvalin J C Worman H J 1997 Domain specific interactions of human HP1 type chromodomain proteins and inner nuclear membrane protein LBR J Biol Chem 272 14983 14989 PMID 9169472 DOI 10 1074 jbc 272 23 14983 Minc E Allory Y Worman H J Courvalin J C Buendia B 1999 Localization and phosphorylation of HP1 proteins during the cell cycle in mammalian cells Chromosoma 108 220 234 PMID 10460410 DOI 10 1007 s004120050372 Lachner M O Carroll D Rea S Mechtler K Jenuwein T 2001 Methylation of histone H3 lysine 9 creates a binding site for HP1 proteins Nature 410 116 120 PMID 11242053 DOI 10 1038 35065132 Lechner M S Schultz D C Negorev D Maul G G Rauscher F J III 2005 The mammalian heterochromatin protein 1 binds diverse nuclear proteins through a common motif that targets the chromoshadow domain Biochem Biophys Res Commun 331 929 937 PMID 15882967 DOI 10 1016 j bbrc 2005 04 016PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 1555 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 30 serpnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 12 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi