Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

CYBA англ Cytochrome b 245 alpha chain білок який кодується однойменним геном розташованим у людей на короткому плечі 16

CYBA

CYBA

CYBA (англ. Cytochrome b-245 alpha chain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми. Довжина поліпептидного ланцюга білка становить 195 амінокислот, а молекулярна маса — 21 013.

CYBA
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CYBA, p22-PHOX, Cytochrome b-245, alpha polypeptide, cytochrome b-245 alpha chain, CGD4
Зовнішні ІД OMIM: 608508 MGI: 1316658 HomoloGene: 80 GeneCards: CYBA
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
1535
13057
Ensembl
ENSG00000051523
ENSMUSG00000006519
UniProt
P13498
Q61462
RefSeq (мРНК)
NM_000101
NM_001301284
NM_007806
RefSeq (білок)
NP_000092
NP_001288213
NP_031832
Локус (UCSC) Хр. 16: 88.64 – 88.65 Mb Хр. 8: 123.15 – 123.16 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVC
LLEYPRGKRKKGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVP
AGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQ
PPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV

Кодований геном білок за функціями належить до оксидоредуктаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як транспорт, транспорт електронів. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом, НАДФ. Локалізований у клітинній мембрані, мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Dinauer M.C., Pierce E.A., Bruns G.A.P., Curnutte J.T., Orkin S.H. (1990). Human neutrophil cytochrome b light chain (p22-phox). Gene structure, chromosomal location, and mutations in cytochrome-negative autosomal recessive chronic granulomatous disease. J. Clin. Invest. 86: 1729—1737. PMID 2243141 DOI:10.1172/JCI114898
  • Ueno N., Takeya R., Miyano K., Kikuchi H., Sumimoto H. (2005). The NADPH oxidase Nox3 constitutively produces superoxide in a p22phox-dependent manner: its regulation by oxidase organizers and activators. J. Biol. Chem. 280: 23328—23339. PMID 15824103 DOI:10.1074/jbc.M414548200
  • Martyn K.D., Frederick L.M., von Loehneysen K., Dinauer M.C., Knaus U.G. (2006). Functional analysis of Nox4 reveals unique characteristics compared to other NADPH oxidases. Cell. Signal. 18: 69—82. PMID 15927447 DOI:10.1016/j.cellsig.2005.03.023
  • Hossle J.-P., de Boer M., Seger R.A., Roos D. (1994). Identification of allele-specific p22-phox mutations in a compound heterozygous patient with chronic granulomatous disease by mismatch PCR and restriction enzyme analysis. Hum. Genet. 93: 437—442. PMID 8168815 DOI:10.1007/BF00201671
  • Ishibashi F., Nunoi H., Endo F., Matsuda I., Kanegasaki S. (2000). Statistical and mutational analysis of chronic granulomatous disease in Japan with special reference to gp91-phox and p22-phox deficiency. Hum. Genet. 106: 473—481. PMID 10914676 DOI:10.1007/s004390000288

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:2577 (англ.) . Процитовано 11 вересня 2017.
  4. (англ.) . Архів оригіналу за 29 серпня 2017. Процитовано 11 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

CYBA angl Cytochrome b 245 alpha chain bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 16 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 195 aminokislot a molekulyarna masa 21 013 CYBANayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1WLPIdentifikatoriSimvoliCYBA p22 PHOX Cytochrome b 245 alpha polypeptide cytochrome b 245 alpha chain CGD4Zovnishni ID OMIM 608508 MGI 1316658 HomoloGene 80 GeneCards CYBAOntologiya genaMolekulyarna funkciya SH3 domain binding zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding heme binding protein heterodimerization activity electron transfer activity oxidoreductase activity superoxide generating NAD P H oxidase activityKlitinna komponenta citoplazma endosoma phagocytic vesicle membrane kompleks Goldzhi membrana klitinna membrana perinuclear endoplasmic reticulum secretory granule neuronal cell body NADFN oksidaza dendrit nejrobiologiya apical plasma membrane mitohondriya klitinne yadro endoplasmic reticulum membrane stress fiber focal adhesion specific granule membrane tertiary granule membraneBiologichnij proces positive regulation of reactive oxygen species biosynthetic process cellular response to organic substance positive regulation of phagocytosis cytochrome complex assembly response to interleukin 1 positive regulation of endothelial cell proliferation antigen processing and presentation of exogenous peptide antigen via MHC class I TAP dependent regulation of release of sequestered calcium ion into cytosol cellular response to tumor necrosis factor GO 1904579 cellular response to organic cyclic compound negative regulation of glomerular filtration by angiotensin smooth muscle hypertrophy positive regulation of defense response to bacterium cell redox homeostasis reactive oxygen species metabolic process superoxide anion generation respiratory burst regulation of blood pressure cellular response to mechanical stimulus positive regulation of cell growth vascular endothelial growth factor receptor signaling pathway response to nutrient levels cellular response to gamma radiation positive regulation of interleukin 6 production positive regulation of tumor necrosis factor production cellular response to amino acid stimulus hydrogen peroxide biosynthetic process positive regulation of toll like receptor 2 signaling pathway positive regulation of superoxide anion generation vrodzhenij imunitet inflammatory response positive regulation of mucus secretion cellular response to glucose stimulus superoxide metabolic process positive regulation of smooth muscle cell proliferation response to aldosterone positive regulation of NAD P H oxidase activity cellular response to L glutamine response to hypoxia cellular response to angiotensin response to activity neutrophil degranulation cellular response to oxidative stress Elektrontransportnij lancyug positive regulation of blood pressureDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1535 13057Ensembl ENSG00000051523 ENSMUSG00000006519UniProt P13498 Q61462RefSeq mRNK NM 000101NM 001301284 NM 007806RefSeq bilok NP 000092NP 001288213 NP 031832Lokus UCSC Hr 16 88 64 88 65 MbHr 8 123 15 123 16 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVC LLEYPRGKRKKGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVP AGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQ PPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do oksidoreduktaz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak transport transport elektroniv Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom zaliza gemom NADF Lokalizovanij u klitinnij membrani membrani LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Dinauer M C Pierce E A Bruns G A P Curnutte J T Orkin S H 1990 Human neutrophil cytochrome b light chain p22 phox Gene structure chromosomal location and mutations in cytochrome negative autosomal recessive chronic granulomatous disease J Clin Invest 86 1729 1737 PMID 2243141 DOI 10 1172 JCI114898 Ueno N Takeya R Miyano K Kikuchi H Sumimoto H 2005 The NADPH oxidase Nox3 constitutively produces superoxide in a p22phox dependent manner its regulation by oxidase organizers and activators J Biol Chem 280 23328 23339 PMID 15824103 DOI 10 1074 jbc M414548200 Martyn K D Frederick L M von Loehneysen K Dinauer M C Knaus U G 2006 Functional analysis of Nox4 reveals unique characteristics compared to other NADPH oxidases Cell Signal 18 69 82 PMID 15927447 DOI 10 1016 j cellsig 2005 03 023 Hossle J P de Boer M Seger R A Roos D 1994 Identification of allele specific p22 phox mutations in a compound heterozygous patient with chronic granulomatous disease by mismatch PCR and restriction enzyme analysis Hum Genet 93 437 442 PMID 8168815 DOI 10 1007 BF00201671 Ishibashi F Nunoi H Endo F Matsuda I Kanegasaki S 2000 Statistical and mutational analysis of chronic granulomatous disease in Japan with special reference to gp91 phox and p22 phox deficiency Hum Genet 106 473 481 PMID 10914676 DOI 10 1007 s004390000288PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 2577 angl Procitovano 11 veresnya 2017 angl Arhiv originalu za 29 serpnya 2017 Procitovano 11 veresnya 2017 Div takozhHromosoma 16 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ