PIN1 (англ. Peptidylprolyl cis/trans isomerase, NIMA-interacting 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 163 амінокислот, а молекулярна маса — 18 243.
PIN1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | PIN1, DOD, UBL5, peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 601052 MGI: 1346036 HomoloGene: 4531 GeneCards: PIN1 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 19: 9.84 – 9.85 Mb | Хр. 9: 20.56 – 20.58 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MADEEKLPPG | WEKRMSRSSG | RVYYFNHITN | ASQWERPSGN | SSSGGKNGQG | ||||
EPARVRCSHL | LVKHSQSRRP | SSWRQEKITR | TKEEALELIN | GYIQKIKSGE | ||||
EDFESLASQF | SDCSSAKARG | DLGAFSRGQM | QKPFEDASFA | LRTGEMSGPV | ||||
FTDSGIHIIL | RTE |
Кодований геном білок за функціями належить до ізомераз, , фосфопротеїнів. Задіяний у таких біологічних процесах, як клітинний цикл, ацетилювання. Локалізований у цитоплазмі, ядрі.
Література
- Lu K.P., Hanes S.D., Hunter T. (1996). A human peptidyl-prolyl isomerase essential for regulation of mitosis. Nature. 380: 544—547. PMID 8606777 DOI:10.1038/380544a0
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Kamimoto T., Zama T., Aoki R., Muro Y., Hagiwara M. (2001). Identification of a novel kinesin-related protein, KRMP1, as a target for mitotic peptidyl-prolyl isomerase Pin1. J. Biol. Chem. 276: 37520—37528. PMID 11470801 DOI:10.1074/jbc.M106207200
- Phan R.T., Saito M., Kitagawa Y., Means A.R., Dalla-Favera R. (2007). Genotoxic stress regulates expression of the proto-oncogene Bcl6 in germinal center B cells. Nat. Immunol. 8: 1132—1139. PMID 17828269 DOI:10.1038/ni1508
- Buschdorf J.P., Chew L.L., Soh U.J., Liou Y.C., Low B.C. (2008). Nerve growth factor stimulates interaction of Cayman ataxia protein BNIP-H/Caytaxin with peptidyl-prolyl isomerase Pin1 in differentiating neurons. PLoS ONE. 3: E2686—E2686. PMID 18628984 DOI:10.1371/journal.pone.0002686
- Lim J.H., Liu Y., Reineke E., Kao H.Y. (2011). Mitogen-activated protein kinase extracellular signal-regulated kinase 2 phosphorylates and promotes Pin1 protein-dependent promyelocytic leukemia protein turnover. J. Biol. Chem. 286: 44403—44411. PMID 22033920 DOI:10.1074/jbc.M111.289512
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 6 травня 2017. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 17 серпня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
На цю статтю не посилаються інші статті Вікіпедії. Будь ласка розставте посилання відповідно до . |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
PIN1 angl Peptidylprolyl cis trans isomerase NIMA interacting 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 163 aminokislot a molekulyarna masa 18 243 PIN1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1F8A 1I6C 1I8G 1I8H 1NMV 1NMW 1PIN 1ZCN 2F21 2ITK 2KBU 2KCF 2LB3 2M8I 2M8J 2M9E 2M9F 2M9I 2M9J 2Q5A 2RUC 2RUD 2XP3 2XP4 2XP5 2XP6 2XP7 2XP8 2XP9 2XPA 2XPB 2ZQS 2ZQT 2ZQU 2ZQV 2ZR4 2ZR5 2ZR6 3I6C 3IK8 3IKD 3IKG 3JYJ 3KAB 3KAC 3KAD 3KAF 3KAG 3KAH 3KAI 3KCE 3NTP 3ODK 3OOB 3TC5 3TCZ 3TDB 3WH0 4GWT 4GWV 4QIB 4TNS 4TYO 4U84 4U85 4U86 2RUQ 2N1O 2RURIdentifikatoriSimvoliPIN1 DOD UBL5 peptidylprolyl cis trans isomerase NIMA interacting 1Zovnishni ID OMIM 601052 MGI 1346036 HomoloGene 4531 GeneCards PIN1Ontologiya genaMolekulyarna funkciya GTPase activating protein binding beta catenin binding isomerase activity peptidyl prolyl cis trans isomerase activity GO 0001948 GO 0016582 protein binding mitogen activated protein kinase kinase binding cytoskeletal motor activity phosphoserine residue binding phosphothreonine residue binding tau protein binding phosphoprotein binding cis trans isomerase activityKlitinna komponenta citoplazma gialoplazma nuclear speck midbody mitohondriya neuron projection klitinne yadro nukleoplazma glutamatergic synapse postsynaptic cytosolBiologichnij proces GO 1904089 negative regulation of neuron apoptotic process positive regulation of protein phosphorylation regulation of cytokinesis positive regulation of protein dephosphorylation GO 1903363 negative regulation of protein catabolic process positive regulation of canonical Wnt signaling pathway synapse organization negative regulation of cell motility protein stabilization negative regulation of transforming growth factor beta receptor signaling pathway negative regulation of protein binding protein peptidyl prolyl isomerization regulation of protein localization to nucleus GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity positive regulation of neuron apoptotic process positive regulation of ubiquitin protein transferase activity neuron differentiation negative regulation of ERK1 and ERK2 cascade klitinnij cikl negative regulation of type I interferon production positive regulation of cell growth involved in cardiac muscle cell development regulation of pathway restricted SMAD protein phosphorylation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II regulation of mitotic nuclear division regulation of signal transduction by p53 class mediator regulation of protein phosphorylation regulyaciya ekspresiyi geniv positive regulation of protein binding microtubule polymerization response to hypoxia regulation of protein stability negative regulation of amyloid beta formationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5300 23988Ensembl ENSG00000127445 ENSMUSG00000032171UniProt Q13526 Q9QUR7RefSeq mRNK NM 006221NM 023371 NM 001364495RefSeq bilok NP 006212NP 075860 NP 001351424Lokus UCSC Hr 19 9 84 9 85 MbHr 9 20 56 20 58 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQG EPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGE EDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPV FTDSGIHIILRTE A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do izomeraz fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak klitinnij cikl acetilyuvannya Lokalizovanij u citoplazmi yadri LiteraturaLu K P Hanes S D Hunter T 1996 A human peptidyl prolyl isomerase essential for regulation of mitosis Nature 380 544 547 PMID 8606777 DOI 10 1038 380544a0 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Kamimoto T Zama T Aoki R Muro Y Hagiwara M 2001 Identification of a novel kinesin related protein KRMP1 as a target for mitotic peptidyl prolyl isomerase Pin1 J Biol Chem 276 37520 37528 PMID 11470801 DOI 10 1074 jbc M106207200 Phan R T Saito M Kitagawa Y Means A R Dalla Favera R 2007 Genotoxic stress regulates expression of the proto oncogene Bcl6 in germinal center B cells Nat Immunol 8 1132 1139 PMID 17828269 DOI 10 1038 ni1508 Buschdorf J P Chew L L Soh U J Liou Y C Low B C 2008 Nerve growth factor stimulates interaction of Cayman ataxia protein BNIP H Caytaxin with peptidyl prolyl isomerase Pin1 in differentiating neurons PLoS ONE 3 E2686 E2686 PMID 18628984 DOI 10 1371 journal pone 0002686 Lim J H Liu Y Reineke E Kao H Y 2011 Mitogen activated protein kinase extracellular signal regulated kinase 2 phosphorylates and promotes Pin1 protein dependent promyelocytic leukemia protein turnover J Biol Chem 286 44403 44411 PMID 22033920 DOI 10 1074 jbc M111 289512PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 6 travnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 17 serpnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Na cyu stattyu ne posilayutsya inshi statti Vikipediyi Bud laska rozstavte posilannya vidpovidno do prijnyatih rekomendacij