S1PR1 (англ. Sphingosine-1-phosphate receptor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 382 амінокислот, а молекулярна маса — 42 811.
S1PR1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | S1PR1, CD363, CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, S1P1, sphingosine-1-phosphate receptor 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 601974 MGI: 1096355 HomoloGene: 1071 GeneCards: S1PR1 | ||||||||||||||||
Реагує на сполуку | |||||||||||||||||
lysophosphatidic acid, sphingosine 1-phosphate, Ponesimod, ozanimod, siponimod | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 101.24 – 101.24 Mb | Хр. 3: 115.5 – 115.51 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MGPTSVPLVK | AHRSSVSDYV | NYDIIVRHYN | YTGKLNISAD | KENSIKLTSV | ||||
VFILICCFII | LENIFVLLTI | WKTKKFHRPM | YYFIGNLALS | DLLAGVAYTA | ||||
NLLLSGATTY | KLTPAQWFLR | EGSMFVALSA | SVFSLLAIAI | ERYITMLKMK | ||||
LHNGSNNFRL | FLLISACWVI | SLILGGLPIM | GWNCISALSS | CSTVLPLYHK | ||||
HYILFCTTVF | TLLLLSIVIL | YCRIYSLVRT | RSRRLTFRKN | ISKASRSSEK | ||||
SLALLKTVII | VLSVFIACWA | PLFILLLLDV | GCKVKTCDIL | FRAEYFLVLA | ||||
VLNSGTNPII | YTLTNKEMRR | AFIRIMSCCK | CPSGDSAGKF | KRPIIAGMEF | ||||
SRSKSDNSSH | PQKDEGDNPE | TIMSSGNVNS | SS |
Кодований геном білок за функціями належить до рецепторів, g-білокспряжених рецепторів, , фосфопротеїнів. Задіяний у таких біологічних процесах як ангіогенез, хемотаксис, поліморфізм, ацетиляція. Локалізований у клітинній мембрані, мембрані, ендосомах.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Lee M.-J., Evans M., Hla T. (1996). The inducible G protein-coupled receptor edg-1 signals via the G(i)/mitogen-activated protein kinase pathway. J. Biol. Chem. 271: 11272—11279. PMID 8626678 DOI:10.1074/jbc.271.19.11272
- Ancellin N., Hla T. (1999). Differential pharmacological properties and signal transduction of the sphingosine 1-phosphate receptors EDG-1, EDG-3, and EDG-5. J. Biol. Chem. 274: 18997—19002. PMID 10383399 DOI:10.1074/jbc.274.27.18997
- Kohno T., Igarashi Y. (2004). Roles for N-glycosylation in the dynamics of Edg-1/S1P1 in sphingosine 1-phosphate-stimulated cells. Glycoconj. J. 21: 497—501. PMID 15750791 DOI:10.1007/s10719-004-5540-8
- Hla T., Maciag T. (1990). An abundant transcript induced in differentiating human endothelial cells encodes a polypeptide with structural similarities to G-protein-coupled receptors. J. Biol. Chem. 265: 9308—9313. PMID 2160972
Примітки
- Сполуки, які фізично взаємодіють з Sphingosine-1-phosphate receptor 1 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 23 серпня 2017. Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 23 серпня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
S1PR1 angl Sphingosine 1 phosphate receptor 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 382 aminokislot a molekulyarna masa 42 811 S1PR1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB3V2W 3V2YIdentifikatoriSimvoliS1PR1 CD363 CHEDG1 D1S3362 ECGF1 EDG 1 EDG1 S1P1 sphingosine 1 phosphate receptor 1Zovnishni ID OMIM 601974 MGI 1096355 HomoloGene 1071 GeneCards S1PR1Reaguye na spolukulysophosphatidic acid sphingosine 1 phosphate Ponesimod ozanimod siponimod Ontologiya genaMolekulyarna funkciya sphingolipid binding sphingosine 1 phosphate receptor activity G protein coupled receptor activity signal transducer activity G protein coupled receptor binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta integral component of membrane endosoma membrana intrinsic component of plasma membrane klitinna membrana membrane raft external side of plasma membrane nukleoplazma vnutrishnoklitinna membranna organelaBiologichnij proces actin cytoskeleton reorganization T cell migration G protein coupled receptor signaling pathway heart trabecula morphogenesis positive regulation of cytosolic calcium ion concentration involved in phospholipase C activating G protein coupled signaling pathway adenylate cyclase inhibiting G protein coupled receptor signaling pathway sphingosine 1 phosphate receptor signaling pathway positive regulation of cell migration regulation of bone mineralization transmission of nerve impulse hemotaksis positive regulation of positive chemotaxis GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity brain development regulation of cell adhesion adgeziya klitin Angiogenez neuron differentiation positive regulation of cell population proliferation endothelial cell differentiation negative regulation of stress fiber assembly regulation of bone resorption cell migration GO 0072468 signalna transdukciya lamellipodium assembly GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II cardiac muscle tissue growth involved in heart morphogenesis positive regulation of smooth muscle cell proliferation blood vessel maturation leukocyte chemotaxis cytokine mediated signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez1901 13609Ensembl ENSG00000170989 ENSMUSG00000045092UniProt P21453 O08530RefSeq mRNK NM 001400 NM 001320730NM 007901RefSeq bilok NP 001307659 NP 001391NP 031927Lokus UCSC Hr 1 101 24 101 24 MbHr 3 115 5 115 51 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSV VFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTA NLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMK LHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHK HYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEK SLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEF SRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do receptoriv g bilokspryazhenih receptoriv fosfoproteyiniv Zadiyanij u takih biologichnih procesah yak angiogenez hemotaksis polimorfizm acetilyaciya Lokalizovanij u klitinnij membrani membrani endosomah LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Lee M J Evans M Hla T 1996 The inducible G protein coupled receptor edg 1 signals via the G i mitogen activated protein kinase pathway J Biol Chem 271 11272 11279 PMID 8626678 DOI 10 1074 jbc 271 19 11272 Ancellin N Hla T 1999 Differential pharmacological properties and signal transduction of the sphingosine 1 phosphate receptors EDG 1 EDG 3 and EDG 5 J Biol Chem 274 18997 19002 PMID 10383399 DOI 10 1074 jbc 274 27 18997 Kohno T Igarashi Y 2004 Roles for N glycosylation in the dynamics of Edg 1 S1P1 in sphingosine 1 phosphate stimulated cells Glycoconj J 21 497 501 PMID 15750791 DOI 10 1007 s10719 004 5540 8 Hla T Maciag T 1990 An abundant transcript induced in differentiating human endothelial cells encodes a polypeptide with structural similarities to G protein coupled receptors J Biol Chem 265 9308 9313 PMID 2160972PrimitkiSpoluki yaki fizichno vzayemodiyut z Sphingosine 1 phosphate receptor 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 23 serpnya 2017 Procitovano 25 serpnya 2017 angl Arhiv originalu za 23 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi