Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

PLN англ Phospholamban білок який кодується однойменним геном розташованим у людей на короткому плечі 6 ї хромосоми Довж

Фосфоламбан

Фосфоламбан

PLN (англ. Phospholamban) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. Довжина поліпептидного ланцюга білка становить 52 амінокислот, а молекулярна маса — 6 109.

PLN
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PLN, CMD1P, CMH18, PLB, phospholamban
Зовнішні ІД OMIM: 172405 MGI: 97622 HomoloGene: 136758 GeneCards: PLN
Пов'язані генетичні захворювання
dilated cardiomyopathy 1P, hypertrophic cardiomyopathy 18, кардіоміопатія, intrinsic cardiomyopathy, гіпертрофічна кардіоміопатія
Шаблон експресії
image

image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
5350
18821
Ensembl
ENSG00000198523
ENSMUSG00000038583
UniProt
P26678
P61014
RefSeq (мРНК)
NM_002667
NM_001141927
NM_023129
RefSeq (білок)
NP_002658
NP_001135399
NP_075618
Локус (UCSC) Хр. 6: 118.55 – 118.56 Mb Хр. 10: 53.21 – 53.22 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVM
LL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як ацетилювання. Локалізований у мембрані, мітохондрії, ендоплазматичному ретикулумі, саркоплазматичному ретикулумі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Rose A.J., Kiens B., Richter E.A. (2006). Ca2+-calmodulin-dependent protein kinase expression and signalling in skeletal muscle during exercise. J. Physiol. (Lond.). 574: 889—903. PMID 16690701 DOI:10.1113/jphysiol.2006.111757
  • Ceholski D.K., Trieber C.A., Holmes C.F., Young H.S. (2012). Lethal, hereditary mutants of phospholamban elude phosphorylation by protein kinase A. J. Biol. Chem. 287: 26596—26605. PMID 22707725 DOI:10.1074/jbc.M112.382713
  • Adams P.D., Arkin I.T., Engelman D.M., Bruenger A.T. (1995). Computational searching and mutagenesis suggest a structure for the pentameric transmembrane domain of phospholamban. Nat. Struct. Biol. 2: 154—162. PMID 7749920 DOI:10.1038/nsb0295-154
  • Herzyk P., Hubbard R.E. (1998). Using experimental information to produce a model of the transmembrane domain of the ion channel phospholamban. Biophys. J. 74: 1203—1214. PMID 9512019 DOI:10.1016/S0006-3495(98)77835-X
  • Oxenoid K., Chou J.J. (2005). The structure of phospholamban pentamer reveals a channel-like architecture in membranes. Proc. Natl. Acad. Sci. U.S.A. 102: 10870—10875. PMID 16043693 DOI:10.1073/pnas.0504920102

Примітки

  1. Захворювання, генетично пов'язані з PLN переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:9080 (англ.) . Процитовано 6 вересня 2017.
  5. (англ.) . Архів оригіналу за 7 жовтня 2017. Процитовано 6 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

PLN angl Phospholamban bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 6 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 52 aminokislot a molekulyarna masa 6 109 PLNNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1PLP 1ZLL 2HYNIdentifikatoriSimvoliPLN CMD1P CMH18 PLB phospholambanZovnishni ID OMIM 172405 MGI 97622 HomoloGene 136758 GeneCards PLNPov yazani genetichni zahvoryuvannyadilated cardiomyopathy 1P hypertrophic cardiomyopathy 18 kardiomiopatiya intrinsic cardiomyopathy gipertrofichna kardiomiopatiya Ontologiya genaMolekulyarna funkciya GO 0048551 enzyme inhibitor activity ATPase binding calcium channel regulator activity GO 0001948 GO 0016582 protein binding ATPase inhibitor activity identical protein binding protein homodimerization activityKlitinna komponenta integral component of membrane vezikula endoplasmic reticulum membrane membrana mitohondrialna membrana sarcoplasmic reticulum endoplazmatichnij retikulum mitohondriya sarcoplasmic reticulum membrane perinuclear region of cytoplasm calcium ion transporting ATPase complex GO 0009327 protein containing complexBiologichnij proces Signalnij shlyah Notch regulation of ryanodine sensitive calcium release channel activity negative regulation of calcium ion binding regulation of cardiac conduction regulation of calcium ion transport GO 0048553 negative regulation of catalytic activity regulation of heart contraction regulation of cytosolic calcium ion concentration cardiac muscle tissue development negative regulation of heart contraction response to testosterone regulation of the force of heart contraction regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion negative regulation of ATP dependent activity regulation of ATPase coupled calcium transmembrane transporter activity regulation of calcium ion import response to zinc ion cellular calcium ion homeostasis regulation of relaxation of cardiac muscle negative regulation of calcium ion transmembrane transporter activity krovoobig negative regulation of heart rate negative regulation of calcium ion import response to insulin regulation of cardiac muscle cell contraction negative regulation of ATPase coupled calcium transmembrane transporter activity negative regulation of calcium ion transport adenylate cyclase activating adrenergic receptor signaling pathway involved in heart process regulation of cardiac muscle cell membrane potential regulation of the force of heart contraction by cardiac conduction regulation of relaxation of muscle negative regulation of calcium ion import into sarcoplasmic reticulum protein homooligomerization regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum relaxation of cardiac muscle calcium ion transportDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez5350 18821Ensembl ENSG00000198523 ENSMUSG00000038583UniProt P26678 P61014RefSeq mRNK NM 002667NM 001141927 NM 023129RefSeq bilok NP 002658NP 001135399 NP 075618Lokus UCSC Hr 6 118 55 118 56 MbHr 10 53 21 53 22 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVM LL A Alanin C Cisteyin E Glutaminova kislota F Fenilalanin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Zadiyanij u takomu biologichnomu procesi yak acetilyuvannya Lokalizovanij u membrani mitohondriyi endoplazmatichnomu retikulumi sarkoplazmatichnomu retikulumi LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Rose A J Kiens B Richter E A 2006 Ca2 calmodulin dependent protein kinase expression and signalling in skeletal muscle during exercise J Physiol Lond 574 889 903 PMID 16690701 DOI 10 1113 jphysiol 2006 111757 Ceholski D K Trieber C A Holmes C F Young H S 2012 Lethal hereditary mutants of phospholamban elude phosphorylation by protein kinase A J Biol Chem 287 26596 26605 PMID 22707725 DOI 10 1074 jbc M112 382713 Adams P D Arkin I T Engelman D M Bruenger A T 1995 Computational searching and mutagenesis suggest a structure for the pentameric transmembrane domain of phospholamban Nat Struct Biol 2 154 162 PMID 7749920 DOI 10 1038 nsb0295 154 Herzyk P Hubbard R E 1998 Using experimental information to produce a model of the transmembrane domain of the ion channel phospholamban Biophys J 74 1203 1214 PMID 9512019 DOI 10 1016 S0006 3495 98 77835 X Oxenoid K Chou J J 2005 The structure of phospholamban pentamer reveals a channel like architecture in membranes Proc Natl Acad Sci U S A 102 10870 10875 PMID 16043693 DOI 10 1073 pnas 0504920102PrimitkiZahvoryuvannya genetichno pov yazani z PLN pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 9080 angl Procitovano 6 veresnya 2017 angl Arhiv originalu za 7 zhovtnya 2017 Procitovano 6 veresnya 2017 Div takozhHromosoma 6 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ