Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

Мелакортиновий рецептор 1 англ Melanocortin 1 receptor білок який кодується геном MC1R розташованим у людей на короткому

Мелакортиновий рецептор 1

Мелакортиновий рецептор 1

Мелакортиновий рецептор 1 (англ. Melanocortin 1 receptor) – білок, який кодується геном MC1R, розташованим у людей на короткому плечі 16-ї хромосоми. Довжина поліпептидного ланцюга білка становить 317 амінокислот, а молекулярна маса — 34 706.

Мелакортиновий рецептор 1
Ідентифікатори
Символи MC1R, CMM5, MSH-R, SHEP2, Melanocortin 1 receptor
Зовнішні ІД OMIM: 155555 MGI: 99456 HomoloGene: 1789 GeneCards: MC1R
Пов'язані генетичні захворювання
skin carcinoma, basal-cell carcinoma
Реагує на сполуку
afamelanotide, MT-II
Ортологи
Види Людина Миша
Entrez
4157
17199
Ensembl
ENSG00000258839
ENSMUSG00000074037
UniProt
Q01726
Q01727
RefSeq (мРНК)
NM_002386
NM_008559
RefSeq (білок)
NP_002377
NP_032585
Локус (UCSC) Хр. 16: 89.91 – 89.92 Mb Хр. 8: 124.13 – 124.14 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGL
VSLVENALVVATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILL
LEAGALVARAAVLQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYAL
RYHSIVTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAML
VLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTLTILLGIF
FLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW

Цей білок за функціями належить до рецепторів, G-білокспряжених рецепторів, . Локалізований у клітинній мембрані, мембрані.

Література

  • Mountjoy K.G., Robbins L.S., Mortrud M., Cone R.D. (1992). The cloning of a family of genes that encode the melanocortin receptors. Science. 257: 1248—1251. PMID 1325670 DOI:10.1126/science.1325670
  • Chhajlani V., Wikberg J.E.S. (1992). Molecular cloning and expression of the human melanocyte stimulating hormone receptor cDNA. FEBS Lett. 309: 417—420. PMID 1516719 DOI:10.1016/0014-5793(92)80820-7
  • Chhajlani V., Wikberg J.E.S. (1996). FEBS Lett. 390: 238—238. {{}}: Пропущений або порожній |title= () PMID 8706868 DOI:10.1016/0014-5793(96)81375-5
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Perez-Oliva A.B., Olivares C., Jimenez-Cervantes C., Garcia-Borron J.C. (2009). Mahogunin ring finger-1 (MGRN1) E3 ubiquitin ligase inhibits signaling from melanocortin receptor by competition with Galphas. J. Biol. Chem. 284: 31714—31725. PMID 19737927 DOI:10.1074/jbc.M109.028100
  • Valverde P., Healy F., Jackson I., Rees J.L., Thody A.J. (1995). Variants of the melanocyte-stimulating hormone receptor gene are associated with red hair and fair skin in humans. Nat. Genet. 11: 328—330. PMID 7581459 DOI:10.1038/ng1195-328

Примітки

  1. Захворювання, генетично пов'язані з Мелакортиновий рецептор 1 переглянути/редагувати посилання на ВікіДаних.
  2. Сполуки, які фізично взаємодіють з Мелакортиновий рецептор 1 переглянути/редагувати посилання на ВікіДаних.
  3. Human PubMed Reference:.
  4. Mouse PubMed Reference:.
  5. HUGO Gene Nomenclature Commitee, HGNC:6929 (англ.) . Процитовано 6 лютого 2017.
  6. (англ.) . Архів оригіналу за 29 січня 2017. Процитовано 6 лютого 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

Melakortinovij receptor 1 angl Melanocortin 1 receptor bilok yakij koduyetsya genom MC1R roztashovanim u lyudej na korotkomu plechi 16 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 317 aminokislot a molekulyarna masa 34 706 Melakortinovij receptor 1IdentifikatoriSimvoliMC1R CMM5 MSH R SHEP2 Melanocortin 1 receptorZovnishni ID OMIM 155555 MGI 99456 HomoloGene 1789 GeneCards MC1RPov yazani genetichni zahvoryuvannyaskin carcinoma basal cell carcinoma Reaguye na spolukuafamelanotide MT II Ontologiya genaMolekulyarna funkciya G protein coupled peptide receptor activity G protein coupled receptor activity signal transducer activity melanocyte stimulating hormone receptor activity GO 0001948 GO 0016582 protein binding melanocortin receptor activity ubiquitin protein ligase bindingKlitinna komponenta integral component of membrane membrana klitinna membrana integral component of plasma membrane vnutrishnoklitinnijBiologichnij proces G protein coupled receptor signaling pathway coupled to cyclic nucleotide second messenger multicellular organism development UF zahist negative regulation of tumor necrosis factor production UV damage excision repair GO 0072468 signalna transdukciya positive regulation of protein kinase A signaling GO 0007243 intracellular signal transduction pigmentation GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II positive regulation of protein kinase B signaling positive regulation of protein kinase C signaling G protein coupled receptor signaling pathway adenylate cyclase activating G protein coupled receptor signaling pathway sensory perception of pain melanin biosynthetic processDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez4157 17199Ensembl ENSG00000258839 ENSMUSG00000074037UniProt Q01726 Q01727RefSeq mRNK NM 002386NM 008559RefSeq bilok NP 002377NP 032585Lokus UCSC Hr 16 89 91 89 92 MbHr 8 124 13 124 14 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGL VSLVENALVVATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILL LEAGALVARAAVLQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYAL RYHSIVTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAML VLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTLTILLGIF FLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF HSQELRRTLKEVLTCSW A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Cej bilok za funkciyami nalezhit do receptoriv G bilokspryazhenih receptoriv Lokalizovanij u klitinnij membrani membrani LiteraturaMountjoy K G Robbins L S Mortrud M Cone R D 1992 The cloning of a family of genes that encode the melanocortin receptors Science 257 1248 1251 PMID 1325670 DOI 10 1126 science 1325670 Chhajlani V Wikberg J E S 1992 Molecular cloning and expression of the human melanocyte stimulating hormone receptor cDNA FEBS Lett 309 417 420 PMID 1516719 DOI 10 1016 0014 5793 92 80820 7 Chhajlani V Wikberg J E S 1996 FEBS Lett 390 238 238 a href wiki D0 A8 D0 B0 D0 B1 D0 BB D0 BE D0 BD Cite journal title Shablon Cite journal cite journal a Propushenij abo porozhnij title dovidka PMID 8706868 DOI 10 1016 0014 5793 96 81375 5 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Perez Oliva A B Olivares C Jimenez Cervantes C Garcia Borron J C 2009 Mahogunin ring finger 1 MGRN1 E3 ubiquitin ligase inhibits signaling from melanocortin receptor by competition with Galphas J Biol Chem 284 31714 31725 PMID 19737927 DOI 10 1074 jbc M109 028100 Valverde P Healy F Jackson I Rees J L Thody A J 1995 Variants of the melanocyte stimulating hormone receptor gene are associated with red hair and fair skin in humans Nat Genet 11 328 330 PMID 7581459 DOI 10 1038 ng1195 328PrimitkiZahvoryuvannya genetichno pov yazani z Melakortinovij receptor 1 pereglyanuti redaguvati posilannya na VikiDanih Spoluki yaki fizichno vzayemodiyut z Melakortinovij receptor 1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 6929 angl Procitovano 6 lyutogo 2017 angl Arhiv originalu za 29 sichnya 2017 Procitovano 6 lyutogo 2017 Div takozhHromosoma 16 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ