CD34 (англ. CD34 molecule) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 385 амінокислот, а молекулярна маса — 40 716.
CD34 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | CD34, entrez:947, CD34 molecule | ||||||||||||||||
Зовнішні ІД | OMIM: 142230 MGI: 88329 HomoloGene: 1343 GeneCards: CD34 | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 207.88 – 207.91 Mb | Хр. 1: 194.62 – 194.64 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MLVRRGARAG | PRMPRGWTAL | CLLSLLPSGF | MSLDNNGTAT | PELPTQGTFS | ||||
NVSTNVSYQE | TTTPSTLGST | SLHPVSQHGN | EATTNITETT | VKFTSTSVIT | ||||
SVYGNTNSSV | QSQTSVISTV | FTTPANVSTP | ETTLKPSLSP | GNVSDLSTTS | ||||
TSLATSPTKP | YTSSSPILSD | IKAEIKCSGI | REVKLTQGIC | LEQNKTSSCA | ||||
EFKKDRGEGL | ARVLCGEEQA | DADAGAQVCS | LLLAQSEVRP | QCLLLVLANR | ||||
TEISSKLQLM | KKHQSDLKKL | GILDFTEQDV | ASHQSYSQKT | LIALVTSGAL | ||||
LAVLGITGYF | LMNRRSWSPT | GERLGEDPYY | TENGGGQGYS | SGPGTSPEAQ | ||||
GKASVNRGAQ | ENGTGQATSR | NGHSARQHVV | ADTEL |
Задіяний у такому біологічному процесі як клітинна адгезія. Локалізований у мембрані.
Література
- Satterthwaite A.B., Burn T.C., le Beau M.M., Tenen D.G. (1992). Structure of the gene encoding CD34, a human hematopoietic stem cell antigen. Genomics. 12: 788—794. PMID 1374051 DOI:10.1016/0888-7543(92)90310-O
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Simmons D.L., Satterthwaite A.B., Tenen D.G., Seed B. (1992). Molecular cloning of a cDNA encoding CD34, a sialomucin of human hematopoietic stem cells. J. Immunol. 148: 267—271. PMID 1370171
- Nakamura Y., Komano H., Nakauchi H. (1993). Two alternative forms of cDNA encoding CD34. Exp. Hematol. 21: 236—242. PMID 7678811
- Fackler M.J., Civin C.I., Sutherland D.R., Baker M.A., May W.S. (1990). Activated protein kinase C directly phosphorylates the CD34 antigen on hematopoietic cells. J. Biol. Chem. 265: 11056—11061. PMID 1694174
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- (англ.) . Архів оригіналу за 16 березня 2016. Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 7 серпня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
CD34 angl CD34 molecule bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 385 aminokislot a molekulyarna masa 40 716 CD34IdentifikatoriSimvoliCD34 entrez 947 CD34 moleculeZovnishni ID OMIM 142230 MGI 88329 HomoloGene 1343 GeneCards CD34Ontologiya genaMolekulyarna funkciya transcription factor binding sulfate binding carbohydrate bindingKlitinna komponenta citoplazma integral component of membrane membrana klitinna membrana integral component of plasma membrane extracellular region cell surface basal plasma membrane glomerular endothelium fenestra apical plasma membrane intercellular bridge perinuclear region of cytoplasm lizosoma external side of plasma membrane cell peripheryBiologichnij proces extracellular exosome assembly stem cell proliferation positive regulation of interleukin 10 production cell motility negative regulation of blood coagulation metanephric glomerular mesangial cell differentiation paracrine signaling hematopoietic stem cell proliferation positive regulation of granulocyte colony stimulating factor production negative regulation of gene expression positive regulation of angiogenesis regulation of blood pressure vascular wound healing GO 1901313 positive regulation of gene expression glomerular filtration negative regulation of nitric oxide biosynthetic process adgeziya klitin endothelial cell proliferation mesangial cell matrix adhesion tissue homeostasis positive regulation of vasculogenesis endothelium development regulation of immune response negative regulation of cellular response to heat positive regulation of transforming growth factor beta production glomerular endothelium development negative regulation of tumor necrosis factor production cell matrix adhesion proliferaciya positive regulation of odontogenesis negative regulation of cellular response to hypoxia leukocyte migration GO 0072468 signalna transdukciya transdifferentiation negative regulation of neuron death cell cell adhesion krovotvorennyaDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez947 12490Ensembl ENSG00000174059 ENSMUSG00000016494UniProt P28906 Q64314RefSeq mRNK NM 001025109 NM 001773NM 001111059 NM 133654RefSeq bilok NP 001020280 NP 001764NP 001104529 NP 598415Lokus UCSC Hr 1 207 88 207 91 MbHr 1 194 62 194 64 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTELA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak klitinna adgeziya Lokalizovanij u membrani LiteraturaSatterthwaite A B Burn T C le Beau M M Tenen D G 1992 Structure of the gene encoding CD34 a human hematopoietic stem cell antigen Genomics 12 788 794 PMID 1374051 DOI 10 1016 0888 7543 92 90310 O The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Simmons D L Satterthwaite A B Tenen D G Seed B 1992 Molecular cloning of a cDNA encoding CD34 a sialomucin of human hematopoietic stem cells J Immunol 148 267 271 PMID 1370171 Nakamura Y Komano H Nakauchi H 1993 Two alternative forms of cDNA encoding CD34 Exp Hematol 21 236 242 PMID 7678811 Fackler M J Civin C I Sutherland D R Baker M A May W S 1990 Activated protein kinase C directly phosphorylates the CD34 antigen on hematopoietic cells J Biol Chem 265 11056 11061 PMID 1694174PrimitkiHuman PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 16 bereznya 2016 Procitovano 25 serpnya 2017 angl Arhiv originalu za 7 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi