Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

C1QB англ Complement C1q B chain білок який кодується однойменним геном розташованим у людей на короткому плечі 1 ї хром

C1QB

C1QB

C1QB (англ. Complement C1q B chain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 253 амінокислот, а молекулярна маса — 26 722.

C1QB
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи C1QB, complement C1q B chain
Зовнішні ІД OMIM: 120570 MGI: 88224 HomoloGene: 418 GeneCards: C1QB
Пов'язані генетичні захворювання
C1q deficiency
Ортологи
Види Людина Миша
Entrez
713
12260
Ensembl
ENSG00000173369
ENSMUSG00000036905
UniProt
P02746
P14106
RefSeq (мРНК)
NM_000491
NM_001371184
NM_001378156
NM_009777
RefSeq (білок)
NP_000482
NP_001358113
NP_001365085
NP_033907
Локус (UCSC) Хр. 1: 22.65 – 22.66 Mb Хр. 4: 136.61 – 136.61 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPD
GQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGG
PGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMN
NNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDY
AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
MEA

Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, шлях активації комплементу. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Reid K.B.M. (1985). Molecular cloning and characterization of the complementary DNA and gene coding for the B-chain of subcomponent C1q of the human complement system. Biochem. J. 231: 729—735. PMID 3000358 DOI:10.1042/bj2310729
  • Reid K.B.M., Thompson E.O.P. (1978). Amino acid sequence of the N-terminal 108 amino acid residues of the B chain of subcomponent C1q of the first component of human complement. Biochem. J. 173: 863—868. PMID 708376 DOI:10.1042/bj1730863
  • Reid K.B.M. (1979). Complete amino acid sequences of the three collagen-like regions present in subcomponent C1q of the first component of human complement. Biochem. J. 179: 367—371. PMID 486087 DOI:10.1042/bj1790367
  • Reid K.B.M., Gagnon J., Frampton J. (1982). Completion of the amino acid sequences of the A and B chains of subcomponent C1q of the first component of human complement. Biochem. J. 203: 559—569. PMID 6981411 DOI:10.1042/bj2030559
  • Reid K.B.M., Bentley D.R., Wood K.J. (1984). Cloning and characterization of the complementary DNA for the B chain of normal human serum C1q. Philos. Trans. R. Soc. Lond., B, Biol. Sci. 306: 345—354. PMID 6208566 DOI:10.1098/rstb.1984.0095

Примітки

  1. Захворювання, генетично пов'язані з C1QB переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 26 травня 2017. Процитовано 21 серпня 2017.
  5. (англ.) . Архів оригіналу за 24 липня 2017. Процитовано 21 серпня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

C1QB angl Complement C1q B chain bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 253 aminokislot a molekulyarna masa 26 722 C1QBNayavni strukturiPDBPoshuk ortologiv PDBe RCSBSpisok kodiv PDB1PK6 2JG8 2JG9 2WNU 2WNV 5HZF 5HKJIdentifikatoriSimvoliC1QB complement C1q B chainZovnishni ID OMIM 120570 MGI 88224 HomoloGene 418 GeneCards C1QBPov yazani genetichni zahvoryuvannyaC1q deficiencyOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding protein homodimerization activity serine type endopeptidase activityKlitinna komponenta extracellular region kolagen blood microparticle ekzosoma complement component C1 complex mizhklitinnij prostir collagen containing extracellular matrix sinaps postsynapseBiologichnij proces inner ear development complement activation complement activation classical pathway proces imunnoyi sistemi vrodzhenij imunitet proteoliz regulation of complement activation synapse pruningDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez713 12260Ensembl ENSG00000173369 ENSMUSG00000036905UniProt P02746 P14106RefSeq mRNK NM 000491 NM 001371184 NM 001378156NM 009777RefSeq bilok NP 000482 NP 001358113 NP 001365085NP 033907Lokus UCSC Hr 1 22 65 22 66 MbHr 4 136 61 136 61 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEAA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takih biologichnih procesah yak imunitet vrodzhenij imunitet shlyah aktivaciyi komplementu Sekretovanij nazovni LiteraturaThe status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Reid K B M 1985 Molecular cloning and characterization of the complementary DNA and gene coding for the B chain of subcomponent C1q of the human complement system Biochem J 231 729 735 PMID 3000358 DOI 10 1042 bj2310729 Reid K B M Thompson E O P 1978 Amino acid sequence of the N terminal 108 amino acid residues of the B chain of subcomponent C1q of the first component of human complement Biochem J 173 863 868 PMID 708376 DOI 10 1042 bj1730863 Reid K B M 1979 Complete amino acid sequences of the three collagen like regions present in subcomponent C1q of the first component of human complement Biochem J 179 367 371 PMID 486087 DOI 10 1042 bj1790367 Reid K B M Gagnon J Frampton J 1982 Completion of the amino acid sequences of the A and B chains of subcomponent C1q of the first component of human complement Biochem J 203 559 569 PMID 6981411 DOI 10 1042 bj2030559 Reid K B M Bentley D R Wood K J 1984 Cloning and characterization of the complementary DNA for the B chain of normal human serum C1q Philos Trans R Soc Lond B Biol Sci 306 345 354 PMID 6208566 DOI 10 1098 rstb 1984 0095PrimitkiZahvoryuvannya genetichno pov yazani z C1QB pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 26 travnya 2017 Procitovano 21 serpnya 2017 angl Arhiv originalu za 24 lipnya 2017 Procitovano 21 serpnya 2017 Div takozhHromosoma 1Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ