Azərbaycanca
Беларускі
Dansk
Deutsch
Española
Français
Indonesia
Italiana
日本語
Қазақ
Lietuvos
Nederlands
Português
Русский
සිංහල
แบบไทย
Türkçe
Українська
中國人
United State
Afrikaans
YWHAB (англ. Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми. Довжина поліпептидного ланцюга білка становить 246 амінокислот, а молекулярна маса — 28 082.
| YWHAB | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
 | |||||||||||||||||
| |||||||||||||||||
| Ідентифікатори | |||||||||||||||||
| Символи | YWHAB, GW128, HEL-S-1, HS1, KCIP-1, YWHAA, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta | ||||||||||||||||
| Зовнішні ІД | OMIM: 601289 MGI: 1891917 HomoloGene: 20724 GeneCards: YWHAB | ||||||||||||||||
| |||||||||||||||||
| Шаблон експресії | |||||||||||||||||
   | |||||||||||||||||
| Більше даних | |||||||||||||||||
| Ортологи | |||||||||||||||||
| Види | Людина | Миша | |||||||||||||||
| Entrez |
|
| |||||||||||||||
| Ensembl |
|
| |||||||||||||||
| UniProt |
|
| |||||||||||||||
| RefSeq (мРНК) |
|
| |||||||||||||||
| RefSeq (білок) |
|
| |||||||||||||||
| Локус (UCSC) | Хр. 20: 44.89 – 44.91 Mb | Хр. 2: 163.84 – 163.86 Mb | |||||||||||||||
| PubMed search | |||||||||||||||||
| Вікідані | |||||||||||||||||
| |||||||||||||||||
| 10 | 20 | 30 | 40 | 50 | ||||
|---|---|---|---|---|---|---|---|---|
| MTMDKSELVQ | KAKLAEQAER | YDDMAAAMKA | VTEQGHELSN | EERNLLSVAY | ||||
| KNVVGARRSS | WRVISSIEQK | TERNEKKQQM | GKEYREKIEA | ELQDICNDVL | ||||
| ELLDKYLIPN | ATQPESKVFY | LKMKGDYFRY | LSEVASGDNK | QTTVSNSQQA | ||||
| YQEAFEISKK | EMQPTHPIRL | GLALNFSVFY | YEILNSPEKA | CSLAKTAFDE | ||||
| AIAELDTLNE | ESYKDSTLIM | QLLRDNLTLW | TSENQGDEGD | AGEGEN |
Задіяний у такому біологічному процесі як взаємодія хазяїн-вірус. Локалізований у цитоплазмі.
Література
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Greninger A.L., Knudsen G.M., Betegon M., Burlingame A.L., DeRisi J.L. (2013). ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding. MBio. 4: E00098—E00098. PMID 23572552 DOI:10.1128/mBio.00098-13
- Yoshida K., Yamaguchi T., Natsume T., Kufe D., Miki Y. (2005). JNK phosphorylation of 14-3-3 proteins regulates nuclear targeting of c-Abl in the apoptotic response to DNA damage. Nat. Cell Biol. 7: 278—285. PMID 15696159 DOI:10.1038/ncb1228
- Liu Y., Ross J.F., Bodine P.V.N., Billiard J. (2007). Homodimerization of Ror2 tyrosine kinase receptor induces 14-3-3(beta) phosphorylation and promotes osteoblast differentiation and bone formation. Mol. Endocrinol. 21: 3050—3061. PMID 17717073 DOI:10.1210/me.2007-0323
- Cariolato L., Cavin S., Diviani D. (2011). A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in alpha1-adrenergic receptor-induced p38 activation. J. Biol. Chem. 286: 7925—7937. PMID 21224381 DOI:10.1074/jbc.M110.185645
- Lin A.E., Greco T.M., Dohner K., Sodeik B., Cristea I.M. (2013). A proteomic perspective of inbuilt viral protein regulation: pUL46 tegument protein is targeted for degradation by ICP0 during herpes simplex virus type 1 infection. Mol. Cell. Proteomics. 12: 3237—3252. PMID 23938468 DOI:10.1074/mcp.M113.030866
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:12849 (англ.) . Архів оригіналу за 14 жовтня 2017. Процитовано 6 лютого 2017.
- UniProt, P31946 (англ.) . Архів оригіналу за 14 квітня 2017. Процитовано 6 лютого 2017.
Див. також
 | Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
YWHAB angl Tyrosine 3 monooxygenase tryptophan 5 monooxygenase activation protein beta bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 20 yi hromosomi 3 Dovzhina polipeptidnogo lancyuga bilka stanovit 246 aminokislot a molekulyarna masa 28 082 4 YWHABNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2BQ0 2C23 4DNKIdentifikatoriSimvoliYWHAB GW128 HEL S 1 HS1 KCIP 1 YWHAA tyrosine 3 monooxygenase tryptophan 5 monooxygenase activation protein betaZovnishni ID OMIM 601289 MGI 1891917 HomoloGene 20724 GeneCards YWHABOntologiya genaMolekulyarna funkciya GO 0001106 transcription corepressor activity protein domain specific binding GO 0032403 protein containing complex binding histone deacetylase binding phosphoprotein binding protein C terminus binding GO 0001948 GO 0016582 protein binding enzyme binding phosphoserine residue binding cadherin binding identical protein bindingKlitinna komponenta citoplazma membrana focal adhesion Melanosoma transcription repressor complex perinuclear region of cytoplasm ekzosoma cytoplasmic vesicle membrane klitinne yadro mitohondriya gialoplazma GO 0009327 protein containing complex vakuolya vacuolar membraneBiologichnij proces sortuvannya bilkiv negative regulation of protein dephosphorylation protein heterooligomerization regulation of mRNA stability GO 0048554 positive regulation of catalytic activity hippo signaling cytoplasmic sequestering of protein MAPK cascade positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway membrane organization GO 0022415 viral process GO 0045996 negative regulation of transcription DNA templated negative regulation of G protein coupled receptor signaling pathwayDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7529 54401Ensembl ENSG00000166913 ENSMUSG00000018326UniProt P31946 Q4VY19 Q9CQV8RefSeq mRNK NM 139323 NM 003404NM 018753RefSeq bilok NP 003395 NP 647539NP 061223Lokus UCSC Hr 20 44 89 44 91 MbHr 2 163 84 163 86 MbPubMed search 1 2 VikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAY KNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVL ELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQA YQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDE AIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Zadiyanij u takomu biologichnomu procesi yak vzayemodiya hazyayin virus Lokalizovanij u citoplazmi Literaturared The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Greninger A L Knudsen G M Betegon M Burlingame A L DeRisi J L 2013 ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding MBio 4 E00098 E00098 PMID 23572552 DOI 10 1128 mBio 00098 13 Yoshida K Yamaguchi T Natsume T Kufe D Miki Y 2005 JNK phosphorylation of 14 3 3 proteins regulates nuclear targeting of c Abl in the apoptotic response to DNA damage Nat Cell Biol 7 278 285 PMID 15696159 DOI 10 1038 ncb1228 Liu Y Ross J F Bodine P V N Billiard J 2007 Homodimerization of Ror2 tyrosine kinase receptor induces 14 3 3 beta phosphorylation and promotes osteoblast differentiation and bone formation Mol Endocrinol 21 3050 3061 PMID 17717073 DOI 10 1210 me 2007 0323 Cariolato L Cavin S Diviani D 2011 A kinase anchoring protein AKAP Lbc anchors a PKN based signaling complex involved in alpha1 adrenergic receptor induced p38 activation J Biol Chem 286 7925 7937 PMID 21224381 DOI 10 1074 jbc M110 185645 Lin A E Greco T M Dohner K Sodeik B Cristea I M 2013 A proteomic perspective of inbuilt viral protein regulation pUL46 tegument protein is targeted for degradation by ICP0 during herpes simplex virus type 1 infection Mol Cell Proteomics 12 3237 3252 PMID 23938468 DOI 10 1074 mcp M113 030866Primitkired Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 12849 angl Arhiv originalu za 14 zhovtnya 2017 Procitovano 6 lyutogo 2017 UniProt P31946 angl Arhiv originalu za 14 kvitnya 2017 Procitovano 6 lyutogo 2017 Div takozhred Hromosoma 20 nbsp Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi Otrimano z https uk wikipedia org w index php title YWHAB amp oldid 35770596