XCL1 (англ. X-C motif chemokine ligand 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. Довжина поліпептидного ланцюга білка становить 114 амінокислот, а молекулярна маса — 12 517.
XCL1 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | XCL1, ATAC, LPTN, LTN, SCM-1, SCM-1a, SCM1, SCM1A, SCYC1, X-C motif chemokine ligand 1 | ||||||||||||||||
Зовнішні ІД | OMIM: 600250 MGI: 104593 HomoloGene: 2250 GeneCards: XCL1 | ||||||||||||||||
| |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 1: 168.58 – 168.58 Mb | Хр. 1: 164.76 – 164.76 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MRLLILALLG | ICSLTAYIVE | GVGSEVSDKR | TCVSLTTQRL | PVSRIKTYTI | ||||
TEGSLRAVIF | ITKRGLKVCA | DPQATWVRDV | VRSMDRKSNT | RNNMIQTKPT | ||||
GTQQSTNTAV | TLTG |
Кодований геном білок за функцією належить до цитокінів. Задіяний у такому біологічному процесі як хемотаксис. Секретований назовні.
Література
- Yoshida T., Imai T., Kakizaki M., Nishimura M., Yoshie O. (1995). Molecular cloning of a novel C or gamma type chemokine, SCM-1. FEBS Lett. 360: 155—159. PMID 7875320 DOI:10.1016/0014-5793(95)00093-O
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
Примітки
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:10645 (англ.) . Процитовано 25 серпня 2017.
- (англ.) . Архів оригіналу за 8 серпня 2017. Процитовано 25 серпня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
XCL1 angl X C motif chemokine ligand 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 1 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 114 aminokislot a molekulyarna masa 12 517 XCL1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1J8I 1J9O 2HDM 2JP1 2NYZ 2N54IdentifikatoriSimvoliXCL1 ATAC LPTN LTN SCM 1 SCM 1a SCM1 SCM1A SCYC1 X C motif chemokine ligand 1Zovnishni ID OMIM 600250 MGI 104593 HomoloGene 2250 GeneCards XCL1Ontologiya genaMolekulyarna funkciya chemokine receptor binding cytokine activity protein homodimerization activity chemokine activity CCR chemokine receptor binding GO 0001948 GO 0016582 protein bindingKlitinna komponenta extracellular region mizhklitinnij prostirBiologichnij proces cellular response to transforming growth factor beta stimulus cellular response to interleukin 4 release of sequestered calcium ion into cytosol negative regulation of interferon gamma production positive regulation of T helper 1 cell cytokine production monocyte chemotaxis positive regulation of interleukin 10 production positive regulation of natural killer cell chemotaxis chemokine mediated signaling pathway positive regulation of CD4 positive alpha beta T cell proliferation cellular response to tumor necrosis factor cell cell signaling positive regulation of thymocyte migration response to virus positive regulation of T cell mediated cytotoxicity positive regulation of release of sequestered calcium ion into cytosol negative regulation of T helper 1 type immune response negative regulation of DNA binding transcription factor activity neutrophil chemotaxis hemotaksis positive regulation of leukocyte chemotaxis GO 0032320 GO 0032321 GO 0032855 GO 0043089 GO 0032854 positive regulation of GTPase activity positive regulation of granzyme A production positive regulation of immunoglobulin production in mucosal tissue negative regulation of T cell cytokine production positive regulation of T cell cytokine production cellular response to interleukin 1 positive regulation of T cell chemotaxis mature natural killer cell chemotaxis regulation of inflammatory response positive regulation of ERK1 and ERK2 cascade positive regulation of neutrophil chemotaxis cellular response to interferon gamma GO 0046730 GO 0046737 GO 0046738 GO 0046736 imunna vidpovid positive regulation of B cell chemotaxis positive regulation of transforming growth factor beta production negative regulation of CD4 positive alpha beta T cell proliferation positive regulation of T helper 2 cell cytokine production GO 0045996 negative regulation of transcription DNA templated positive regulation of CD8 positive alpha beta T cell proliferation negative regulation of interleukin 2 production negative regulation of T helper 1 cell activation positive regulation of granzyme B production GO 0072468 signalna transdukciya antimicrobial humoral immune response mediated by antimicrobial peptide regulation of signaling receptor activity G protein coupled receptor signaling pathway inflammatory response lymphocyte chemotaxisDzherela Amigo QuickGOOrtologiVidi Lyudina MishaEntrez6375 16963Ensembl ENSG00000143184 ENSMUSG00000026573UniProt P47992 P47993RefSeq mRNK NM 002995NM 008510RefSeq bilok NP 002986NP 032536Lokus UCSC Hr 1 168 58 168 58 MbHr 1 164 76 164 76 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MRLLILALLGICSLTAYIVEGVGSEVSDKRTCVSLTTQRLPVSRIKTYTI TEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPT GTQQSTNTAVTLTG A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do citokiniv Zadiyanij u takomu biologichnomu procesi yak hemotaksis Sekretovanij nazovni LiteraturaYoshida T Imai T Kakizaki M Nishimura M Yoshie O 1995 Molecular cloning of a novel C or gamma type chemokine SCM 1 FEBS Lett 360 155 159 PMID 7875320 DOI 10 1016 0014 5793 95 00093 O The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 10645 angl Procitovano 25 serpnya 2017 angl Arhiv originalu za 8 serpnya 2017 Procitovano 25 serpnya 2017 Div takozhHromosoma 1 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi