Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

UBB англ Ubiquitin B білок який кодується однойменним геном розташованим у людей на короткому плечі 17 ї хромосоми Довжи

UBB

UBB

UBB (англ. Ubiquitin B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми. Довжина поліпептидного ланцюга білка становить 229 амінокислот, а молекулярна маса — 25 762.

UBB
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи UBB, HEL-S-50, Ubiquitin B
Зовнішні ІД OMIM: 191339 MGI: 98888 HomoloGene: 75104 GeneCards: UBB
Шаблон експресії
image
Більше даних
Ортологи
Види Людина Миша
Entrez
7314
22187
Ensembl
ENSG00000170315
ENSMUSG00000019505
UniProt
P0CG47
P0CG49
RefSeq (мРНК)
NM_011664
NM_001313984
RefSeq (білок)
NP_001300913
NP_035794
Локус (UCSC) Хр. 17: 16.38 – 16.38 Mb Хр. 11: 62.44 – 62.44 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL
EDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR
GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGK
QLEDGRTLSDYNIQKESTLHLVLRLRGGC

Кодований геном білок за функцією належить до фосфопротеїнів. Локалізований у цитоплазмі, ядрі.

Література

  • Baker R.T., Board P.G. (1987). The human ubiquitin gene family: structure of a gene and pseudogenes from the Ub B subfamily. Nucleic Acids Res. 15: 443—463. PMID 3029682 DOI:10.1093/nar/15.2.443
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Schlesinger D.H., Goldstein G. (1975). Molecular conservation of 74 amino acid sequence of ubiquitin between cattle and man. Nature. 255: 423—424. PMID 1128706 DOI:10.1038/255423a0
  • Huang F., Kirkpatrick D., Jiang X., Gygi S.P., Sorkin A. (2006). Differential regulation of EGF receptor internalization and degradation by multiubiquitination within the kinase domain. Mol. Cell. 21: 737—748. PMID 16543144 DOI:10.1016/j.molcel.2006.02.018
  • Okumura F., Hatakeyama S., Matsumoto M., Kamura T., Nakayama K. (2004). Functional regulation of FEZ1 by the U-box-type ubiquitin ligase E4B contributes to neuritogenesis. J. Biol. Chem. 279: 53533—53543. PMID 15466860 DOI:10.1074/jbc.M402916200
  • Komander D. (2009). The emerging complexity of protein ubiquitination. Biochem. Soc. Trans. 37: 937—953. PMID 19754430 DOI:10.1042/BST0370937

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:12463 (англ.) . Процитовано 12 вересня 2017.
  4. (англ.) . Архів оригіналу за 2 листопада 2017. Процитовано 12 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

UBB angl Ubiquitin B bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 17 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 229 aminokislot a molekulyarna masa 25 762 UBBNayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB2KHW 2MBB 2MRO 2MSG 4UEL 4UF6 4WLR 4WUR 4ZPZ 5CAW 3OJ3 5DK8 5CRA 4ZFR 5CVO 3ZLZ 4WHV 4ZFT 3ZNH 5D0M 2Y5B 2KWV 5D0K 5DFL 5CVM 4WZP 5EDV 5CVN 2KWU 4XOF 5BNB 2N13 4ZUX 5IFR 5IBK 5KGF 5JG6 5K9P 5E6JIdentifikatoriSimvoliUBB HEL S 50 Ubiquitin BZovnishni ID OMIM 191339 MGI 98888 HomoloGene 75104 GeneCards UBBOntologiya genaMolekulyarna funkciya GO 0001948 GO 0016582 protein binding protein tag ubiquitin protein ligase bindingKlitinna komponenta citoplazma endocytic vesicle membrane gialoplazma mitohondriya neuron projection klitinne yadro ekzosoma klitinna membrana nukleoplazma neuronal cell body endosome membrane mizhklitinnij prostir mitohondrialna zovnishnya membrana endoplasmic reticulum quality control compartment vezikula endoplasmic reticulum membrane host cellBiologichnij proces DNA damage response signal transduction by p53 class mediator resulting in cell cycle arrest negative regulation of epidermal growth factor receptor signaling pathway interstrand cross link repair nucleotide excision repair DNA damage recognition positive regulation of canonical Wnt signaling pathway tumor necrosis factor mediated signaling pathway regulation of type I interferon production positive regulation of protein monoubiquitination TRIF dependent toll like receptor signaling pathway Fc epsilon receptor signaling pathway endosomal transport global genome nucleotide excision repair NIK NF kappaB signaling G2 M transition of mitotic cell cycle stress activated MAPK cascade transforming growth factor beta receptor signaling pathway macroautophagy negative regulation of canonical Wnt signaling pathway nucleotide excision repair DNA gap filling error free translesion synthesis regulation of tumor necrosis factor mediated signaling pathway stimulatory C type lectin receptor signaling pathway negative regulation of transforming growth factor beta receptor signaling pathway JNK cascade regulation of transcription from RNA polymerase II promoter in response to hypoxia nucleotide excision repair DNA incision I kappaB kinase NF kappaB signaling vrodzhenij imunitet Signalnij shlyah Notch neuron projection morphogenesis regulation of mRNA stability protein polyubiquitination negative regulation of apoptotic process GO 1901227 negative regulation of transcription by RNA polymerase II virion assembly positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator positive regulation of NF kappaB transcription factor activity anaphase promoting complex dependent catabolic process negative regulation of type I interferon production nucleotide binding oligomerization domain containing signaling pathway positive regulation of protein ubiquitination GO 0046795 intracellular transport of virus regulation of proteasomal protein catabolic process GO 0019067 viral life cycle MyD88 dependent toll like receptor signaling pathway error prone translesion synthesis MAPK cascade regulation of mitochondrial membrane potential fibroblast growth factor receptor signaling pathway ion transmembrane transport glycogen biosynthetic process regulation of neuron death positive regulation of apoptotic process positive regulation of I kappaB kinase NF kappaB signaling translesion synthesis transcription coupled nucleotide excision repair mitochondrion transport along microtubule T cell receptor signaling pathway MyD88 independent toll like receptor signaling pathway GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II regulation of signal transduction by p53 class mediator positive regulation of epidermal growth factor receptor signaling pathway Wnt signaling pathway nucleotide excision repair DNA duplex unwinding nucleotide excision repair DNA incision 5 to lesion ERBB2 signaling pathway Wnt signaling pathway planar cell polarity pathway nucleotide excision repair preincision complex assembly proteasome mediated ubiquitin dependent protein catabolic process zgortannya bilkiv negative regulation of G2 M transition of mitotic cell cycle Ubikvitin zalezhnij proteoliz protein deubiquitination SCF dependent proteasomal ubiquitin dependent protein catabolic process entry of bacterium into host cell transmembrannij transport regulation of necroptotic process membrane organization endoplasmic reticulum mannose trimming cellular iron ion homeostasis regulation of hematopoietic stem cell differentiation protein targeting to peroxisome male meiosis I female meiosis I male gonad development female gonad development cytokine mediated signaling pathway modification dependent protein catabolic process hypothalamus gonadotrophin releasing hormone neuron development adipose tissue development fat pad development interleukin 1 mediated signaling pathway seminiferous tubule development energy homeostasisDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7314 22187Ensembl ENSG00000170315 ENSMUSG00000019505UniProt P0CG47 P0CG49RefSeq mRNK NM 018955 NM 001281716 NM 001281717 NM 001281718 NM 001281719NM 001281720NM 011664 NM 001313984RefSeq bilok NP 001268645 NP 001268646 NP 001268647 NP 001268648 NP 001268649NP 061828NP 001300913 NP 035794Lokus UCSC Hr 17 16 38 16 38 MbHr 11 62 44 62 44 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGK QLEDGRTLSDYNIQKESTLHLVLRLRGGC A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin Y Tirozin Kodovanij genom bilok za funkciyeyu nalezhit do fosfoproteyiniv Lokalizovanij u citoplazmi yadri LiteraturaBaker R T Board P G 1987 The human ubiquitin gene family structure of a gene and pseudogenes from the Ub B subfamily Nucleic Acids Res 15 443 463 PMID 3029682 DOI 10 1093 nar 15 2 443 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Schlesinger D H Goldstein G 1975 Molecular conservation of 74 amino acid sequence of ubiquitin between cattle and man Nature 255 423 424 PMID 1128706 DOI 10 1038 255423a0 Huang F Kirkpatrick D Jiang X Gygi S P Sorkin A 2006 Differential regulation of EGF receptor internalization and degradation by multiubiquitination within the kinase domain Mol Cell 21 737 748 PMID 16543144 DOI 10 1016 j molcel 2006 02 018 Okumura F Hatakeyama S Matsumoto M Kamura T Nakayama K 2004 Functional regulation of FEZ1 by the U box type ubiquitin ligase E4B contributes to neuritogenesis J Biol Chem 279 53533 53543 PMID 15466860 DOI 10 1074 jbc M402916200 Komander D 2009 The emerging complexity of protein ubiquitination Biochem Soc Trans 37 937 953 PMID 19754430 DOI 10 1042 BST0370937PrimitkiHuman PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 12463 angl Procitovano 12 veresnya 2017 angl Arhiv originalu za 2 listopada 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 17 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ