Azərbaycanca AzərbaycancaБеларускі БеларускіDansk DanskDeutsch DeutschEspañola EspañolaFrançais FrançaisIndonesia IndonesiaItaliana Italiana日本語 日本語Қазақ ҚазақLietuvos LietuvosNederlands NederlandsPortuguês PortuguêsРусский Русскийසිංහල සිංහලแบบไทย แบบไทยTürkçe TürkçeУкраїнська Українська中國人 中國人United State United StateAfrikaans Afrikaans
Підтримка
www.wikidata.uk-ua.nina.az

TGFB1 англ Transforming growth factor beta 1 білок який кодується однойменним геном розташованим у людей на короткому пл

TGFB1

TGFB1

TGFB1 (англ. Transforming growth factor beta 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. Довжина поліпептидного ланцюга білка становить 390 амінокислот, а молекулярна маса — 44 341.

TGFB1
image
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TGFB1, CED, DPD1, LAP, TGFB, TGFbeta, transforming growth factor beta 1, IBDIMDE, TGF-beta1
Зовнішні ІД OMIM: 190180 MGI: 98725 HomoloGene: 540 GeneCards: TGFB1
Пов'язані генетичні захворювання
Camurati-Engelmann disease
Шаблон експресії
image

image
Більше даних
Ортологи
Види Людина Миша
Entrez
7040
21803
Ensembl
ENSG00000105329
ENSMUSG00000002603
UniProt
P01137
P04202
RefSeq (мРНК)
NM_000660
NM_011577
RefSeq (білок)
NP_000651
NP_035707
Локус (UCSC) Хр. 19: 41.3 – 41.35 Mb Хр. 7: 25.39 – 25.4 Mb
PubMed search
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIR
GQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPE
ADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLL
SRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDV
TGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATI
HGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGA
SAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Кодований геном білок за функціями належить до факторів росту, мітогенів. Локалізований у позаклітинному матриксі. Також секретований назовні.

Література

  • Derynck R., Rhee L., Chen E.Y., van Tilburg A. (1987). Intron-exon structure of the human transforming growth factor-beta precursor gene. Nucleic Acids Res. 15: 3188—3189. PMID 3470709 DOI:10.1093/nar/15.7.3188
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Okamoto O., Fujiwara S., Abe M., Sato Y. (1999). Dermatopontin interacts with transforming growth factor beta and enhances its biological activity. Biochem. J. 337: 537—541. PMID 9895299 DOI:10.1042/bj3370537
  • Shur I., Lokiec F., Bleiberg I., Benayahu D. (2001). Differential gene expression of cultured human osteoblasts. J. Cell. Biochem. 83: 547—553. PMID 11746498 DOI:10.1002/jcb.1249
  • Lewandrowski U., Moebius J., Walter U., Sickmann A. (2006). Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach. Mol. Cell. Proteomics. 5: 226—233. PMID 16263699 DOI:10.1074/mcp.M500324-MCP200
  • Suzuki S., Kulkarni A.B. (2010). Extracellular heat shock protein HSP90beta secreted by MG63 osteosarcoma cells inhibits activation of latent TGF-beta1. Biochem. Biophys. Res. Commun. 398: 525—531. PMID 20599762 DOI:10.1016/j.bbrc.2010.06.112

Примітки

  1. Захворювання, генетично пов'язані з TGFB1 переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. (англ.) . Архів оригіналу за 1 травня 2017. Процитовано 12 вересня 2017.
  5. (англ.) . Архів оригіналу за 19 вересня 2017. Процитовано 12 вересня 2017.

Див. також

image Це незавершена стаття про білки.
Ви можете проєкту, виправивши або дописавши її.

Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет

TGFB1 angl Transforming growth factor beta 1 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 19 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 390 aminokislot a molekulyarna masa 44 341 TGFB1Nayavni strukturiPDBPoshuk ortologiv PDBe RCSB Spisok kodiv PDB1KLA 1KLC 1KLD 3KFD 4KV5IdentifikatoriSimvoliTGFB1 CED DPD1 LAP TGFB TGFbeta transforming growth factor beta 1 IBDIMDE TGF beta1Zovnishni ID OMIM 190180 MGI 98725 HomoloGene 540 GeneCards TGFB1Pov yazani genetichni zahvoryuvannyaCamurati Engelmann disease Ontologiya genaMolekulyarna funkciya type II transforming growth factor beta receptor binding protein N terminus binding cytokine activity enzyme binding growth factor activity GO 0003823 GO 0051635 antigen binding type I transforming growth factor beta receptor binding protein homodimerization activity protein serine threonine kinase activator activity GO 0001948 GO 0016582 protein binding protein heterodimerization activity type III transforming growth factor beta receptor binding transforming growth factor beta receptor binding identical protein bindingKlitinna komponenta citoplazma extracellular region klitinne yadro Mikrovorsinki cell surface blood microparticle klitinna membrana secretory granule akson neuronal cell body Golgi lumen platelet alpha granule lumen GO 0005578 Pozaklitinna matricya mizhklitinnij prostirBiologichnij proces positive regulation of histone deacetylation positive regulation of transcription regulatory region DNA binding ureteric bud development tolerance induction to self antigen positive regulation of protein phosphorylation endoderm development response to cholesterol positive regulation of MAP kinase activity regulation of sodium ion transport response to progesterone negative regulation of cell cycle response to organic substance mammary gland development T cell homeostasis negative regulation of ossification negative regulation of hyaluronan biosynthetic process protein phosphorylation T cell differentiation positive regulation of vascular permeability animal organ regeneration positive regulation of blood vessel endothelial cell migration negative regulation of epithelial cell proliferation regulation of binding inner ear development myelination negative regulation of macrophage cytokine production proliferaciya transforming growth factor beta receptor signaling pathway face morphogenesis negative regulation of cell population proliferation positive regulation of receptor clustering regulation of apoptotic process positive regulation of collagen biosynthetic process cellular response to transforming growth factor beta stimulus pathway restricted SMAD protein phosphorylation regulation of DNA binding regulation of actin cytoskeleton reorganization negative regulation of fat cell differentiation GO 0051247 GO 0051200 positive regulation of protein metabolic process cell cell junction organization negative regulation of myoblast differentiation positive regulation of protein kinase B signaling common partner SMAD protein phosphorylation positive regulation of branching involved in ureteric bud morphogenesis SMAD protein signal transduction epidermal growth factor receptor signaling pathway macrophage derived foam cell differentiation negative regulation of blood vessel endothelial cell migration positive regulation of protein dephosphorylation extrinsic apoptotic signaling pathway negative regulation of extracellular matrix disassembly mitotic cell cycle checkpoint signaling positive regulation of fibroblast proliferation negative regulation of cell differentiation regulation of branching involved in mammary gland duct morphogenesis positive regulation of exit from mitosis negative regulation of transforming growth factor beta receptor signaling pathway negative regulation of gene expression morphogenesis of a branching structure regulation of SMAD protein signal transduction positive regulation of peptidyl serine phosphorylation cell activation negative regulation of neuroblast proliferation GO 0060469 GO 0009371 positive regulation of transcription DNA templated cell growth negative regulation of T cell proliferation response to wounding negative regulation of cell growth positive regulation of chemotaxis protein export from nucleus regulation of protein import into nucleus positive regulation of peptidyl tyrosine phosphorylation positive regulation of protein import into nucleus positive regulation of cardiac muscle cell differentiation oligodendrocyte development positive regulation of interleukin 17 production inflammatory response negative regulation of interleukin 17 production lymph node development T cell activation Signalnij shlyah Notch GO 0033128 negative regulation of protein phosphorylation regulation of blood vessel remodeling SMAD protein complex assembly regulation of striated muscle tissue development response to vitamin D chondrocyte differentiation regulatory T cell differentiation regulation of cartilage development branch elongation involved in mammary gland duct branching positive regulation of bone mineralization positive regulation of epithelial cell proliferation zhinocha vagitnist GO 1904579 cellular response to organic cyclic compound positive regulation of extracellular matrix assembly cellular calcium ion homeostasis Zagoyennya ran GO 1901227 negative regulation of transcription by RNA polymerase II response to glucose positive regulation of epithelial to mesenchymal transition cellular response to dexamethasone stimulus negative regulation of production of miRNAs involved in gene silencing by miRNA GO 0019049 GO 0030683 mitigation of host defenses by virus lens fiber cell differentiation positive regulation of NF kappaB transcription factor activity extracellular matrix assembly ATP biosynthetic process hematopoietic progenitor cell differentiation regulation of interleukin 23 production positive regulation of protein secretion frontal suture morphogenesis Epitelialno mezenhimalnij perehid phosphate containing compound metabolic process regulyaciya ekspresiyi geniv adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains negative regulation of release of sequestered calcium ion into cytosol response to radiation mononuclear cell proliferation GO 0045996 negative regulation of transcription DNA templated negative regulation of T cell activation positive regulation of odontogenesis lipopolysaccharide mediated signaling pathway positive regulation of protein localization to nucleus response to estradiol regulation of cell migration response to hypoxia hyaluronan catabolic process negative regulation of phagocytosis GO 1904578 response to organic cyclic compound positive regulation of protein containing complex assembly protein kinase B signaling negative regulation of cell cell adhesion GO 1905617 negative regulation of gene silencing by miRNA positive regulation of regulatory T cell differentiation cellular response to growth factor stimulus positive regulation of pathway restricted SMAD protein phosphorylation mammary gland branching involved in thelarche response to laminar fluid shear stress GO 0010260 starinnya lyudini regulation of regulatory T cell differentiation platelet degranulation negative regulation of DNA replication myeloid dendritic cell differentiation salivary gland morphogenesis receptor catabolic process MAPK cascade positive regulation of histone acetylation regulation of transforming growth factor beta receptor signaling pathway positive regulation of phosphatidylinositol 3 kinase activity negative regulation of protein localization to plasma membrane positive regulation of NAD ADP ribosyltransferase activity negative regulation of immune response regulation of cell population proliferation negative regulation of skeletal muscle tissue development positive regulation of peptidyl threonine phosphorylation positive regulation of smooth muscle cell differentiation positive regulation of isotype switching to IgA isotypes connective tissue replacement involved in inflammatory response wound healing ossification involved in bone remodeling positive regulation of apoptotic process positive regulation of vascular endothelial growth factor production positive regulation of superoxide anion generation digestive tract development cell migration positive regulation of fibroblast migration positive regulation of cell division germ cell migration GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II negative regulation of mitotic cell cycle positive regulation of SMAD protein signal transduction positive regulation of pri miRNA transcription by RNA polymerase II GO 1901313 positive regulation of gene expression positive regulation of cell population proliferation liver regeneration regulation of epithelial to mesenchymal transition involved in endocardial cushion formation positive regulation of mononuclear cell migration cellular response to insulin like growth factor stimulus positive regulation of cell migration response to immobilization stress cellular response to mechanical stimulus cellular response to ionizing radiation vaskulogenez neural tube closure heart valve morphogenesis heart development neural tube development membrane protein intracellular domain proteolysis leukocyte migration ventricular cardiac muscle tissue morphogenesis positive regulation of ERK1 and ERK2 cascade transforming growth factor beta receptor signaling pathway involved in heart development embryonic liver development BMP signaling pathway rozvitok klitin GO 0097285 apoptoz regulation of pri miRNA transcription by RNA polymerase II positive regulation of production of miRNAs involved in gene silencing by miRNA regulation of signaling receptor activityDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez7040 21803Ensembl ENSG00000105329 ENSMUSG00000002603UniProt P01137 P04202RefSeq mRNK NM 000660NM 011577RefSeq bilok NP 000651NP 035707Lokus UCSC Hr 19 41 3 41 35 MbHr 7 25 39 25 4 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIR GQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPE ADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLL SRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDV TGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATI HGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGA SAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do faktoriv rostu mitogeniv Lokalizovanij u pozaklitinnomu matriksi Takozh sekretovanij nazovni LiteraturaDerynck R Rhee L Chen E Y van Tilburg A 1987 Intron exon structure of the human transforming growth factor beta precursor gene Nucleic Acids Res 15 3188 3189 PMID 3470709 DOI 10 1093 nar 15 7 3188 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Okamoto O Fujiwara S Abe M Sato Y 1999 Dermatopontin interacts with transforming growth factor beta and enhances its biological activity Biochem J 337 537 541 PMID 9895299 DOI 10 1042 bj3370537 Shur I Lokiec F Bleiberg I Benayahu D 2001 Differential gene expression of cultured human osteoblasts J Cell Biochem 83 547 553 PMID 11746498 DOI 10 1002 jcb 1249 Lewandrowski U Moebius J Walter U Sickmann A 2006 Elucidation of N glycosylation sites on human platelet proteins a glycoproteomic approach Mol Cell Proteomics 5 226 233 PMID 16263699 DOI 10 1074 mcp M500324 MCP200 Suzuki S Kulkarni A B 2010 Extracellular heat shock protein HSP90beta secreted by MG63 osteosarcoma cells inhibits activation of latent TGF beta1 Biochem Biophys Res Commun 398 525 531 PMID 20599762 DOI 10 1016 j bbrc 2010 06 112PrimitkiZahvoryuvannya genetichno pov yazani z TGFB1 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference angl Arhiv originalu za 1 travnya 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 19 veresnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma 19 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi

Дата публікації:
Топ