SRY (від англ. sex determining region Y — «ділянка Y-хромосоми, що визначає стать») — білок, який кодується однойменним геном, розташованим у людей на короткому плечі Y-хромосоми. Довжина поліпептидного ланцюга білка становить 204 амінокислот, а молекулярна маса — 23 884.
SRY | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||
Ідентифікатори | |||||||||||||||||
Символи | SRY, SRXX1, SRXY1, TDF, TDY, Testis determining factor, sex determining region Y, Sex-determining region of Y-chromosome, Sex-determining region Y | ||||||||||||||||
Зовнішні ІД | OMIM: 480000 HomoloGene: 48168 GeneCards: SRY | ||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. Y: 2.79 – 2.79 Mb | н/д | |||||||||||||||
PubMed search | н/д | ||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MQSYASAMLS | VFNSDDYSPA | VQENIPALRR | SSSFLCTESC | NSKYQCETGE | ||||
NSKGNVQDRV | KRPMNAFIVW | SRDQRRKMAL | ENPRMRNSEI | SKQLGYQWKM | ||||
LTEAEKWPFF | QEAQKLQAMH | REKYPNYKYR | PRRKAKMLPK | NCSLLPADPA | ||||
SVLCSEVQLD | NRLYRDDCTK | ATHSRMEHQL | GHLPPINAAS | SPQQRDRYSH | ||||
WTKL |
Кодований геном білок за функціями належить до репресорів, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, ацетилювання. Білок має сайт для зв'язування з молекулою кальмодуліну, ДНК. Локалізований у цитоплазмі, ядрі.
SRY є безінтронним геном, він відповідає за процес статевої диференціації на ембріональній стадії розвитку в плацентарних і сумчастих ссавців, появу чоловічих статевих ознак, генез внутрішніх і зовнішніх статевих органів.
Література
- Behlke M.A., Bogan J.S., Beer-Romero P., Page D.C. (1993). Evidence that the SRY protein is encoded by a single exon on the human Y chromosome. Genomics. 17: 736—739. PMID 8244390 DOI:10.1006/geno.1993.1395
- Whitfield L.S., Hawkins J.R., Goodfellow P.N., Sulston J. (1995). 41 kilobases of analyzed sequence from the pseudoautosomal and sex-determining regions of the short arm of the human Y chromosome. Genomics. 27: 306—311. PMID 7557997 DOI:10.1006/geno.1995.1047
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- King C.Y., Weiss M.A. (1993). The SRY high-mobility-group box recognizes DNA by partial intercalation in the minor groove: a topological mechanism of sequence specificity. Proc. Natl. Acad. Sci. U.S.A. 90: 11990—11994. PMID 8265659 DOI:10.1073/pnas.90.24.11990
- Giese K., Pagel J., Grosschedl R. (1994). Distinct DNA-binding properties of the high mobility group domain of murine and human SRY sex-determining factors. Proc. Natl. Acad. Sci. U.S.A. 91: 3368—3372. PMID 8159753 DOI:10.1073/pnas.91.8.3368
- Mayer A., Lahr G., Swaab D.F., Pilgrim C., Reisert I. (1998). The Y-chromosomal genes SRY and ZFY are transcribed in adult human brain. Neurogenetics. 1: 281—288. PMID 10732804 DOI:10.1007/s100480050042
Примітки
- Human PubMed Reference:.
- (англ.) . Архів оригіналу за 12 листопада 2017. Процитовано 12 вересня 2017.
- (англ.) . Архів оригіналу за 26 жовтня 2017. Процитовано 12 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
SRY vid angl sex determining region Y dilyanka Y hromosomi sho viznachaye stat bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi Y hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 204 aminokislot a molekulyarna masa 23 884 SRYNayavni strukturiPDBPoshuk dlya lyudej PDBe RCSBSpisok kodiv PDB1HRY 1HRZ 1J46 1J47 2GZKIdentifikatoriSimvoliSRY SRXX1 SRXY1 TDF TDY Testis determining factor sex determining region Y Sex determining region of Y chromosome Sex determining region YZovnishni ID OMIM 480000 HomoloGene 48168 GeneCards SRYOntologiya genaMolekulyarna funkciya GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity transcription factor binding calmodulin binding transcription factor activity RNA polymerase II distal enhancer sequence specific binding DNA binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific GO 0001948 GO 0016582 protein binding GO 0001077 GO 0001212 GO 0001213 GO 0001211 GO 0001205 DNA binding transcription activator activity RNA polymerase II specificKlitinna komponenta citoplazma nuclear speck nukleoplazma klitinne yadroBiologichnij proces diferenciaciya klitin GO 0009373 regulation of transcription DNA templated sex differentiation transcription DNA templated GO 0060469 GO 0009371 positive regulation of transcription DNA templated positive regulation of male gonad development male sex determination GO 0044324 GO 0003256 GO 1901213 GO 0046019 GO 0046020 GO 1900094 GO 0061216 GO 0060994 GO 1902064 GO 0003258 GO 0072212 regulation of transcription by RNA polymerase II GO 1901227 negative regulation of transcription by RNA polymerase II GO 0003257 GO 0010735 GO 1901228 GO 1900622 GO 1904488 positive regulation of transcription by RNA polymerase II central nervous system development GO 1901313 positive regulation of gene expression neuron differentiationDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6736 n dEnsembl ENSG00000184895 n dUniProt Q05066 n dRefSeq mRNK NM 003140n dRefSeq bilok NP 003131n dLokus UCSC Hr Y 2 79 2 79 Mbn dPubMed search n dVikidaniDiv Red dlya lyudejDiv Red dlya mishejPoslidovnist aminokislot1020304050MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKLA Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv aktivatoriv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi diferenciaciya klitin acetilyuvannya Bilok maye sajt dlya zv yazuvannya z molekuloyu kalmodulinu DNK Lokalizovanij u citoplazmi yadri SRY ye bezintronnim genom vin vidpovidaye za proces statevoyi diferenciaciyi na embrionalnij stadiyi rozvitku v placentarnih i sumchastih ssavciv poyavu cholovichih statevih oznak genez vnutrishnih i zovnishnih statevih organiv LiteraturaBehlke M A Bogan J S Beer Romero P Page D C 1993 Evidence that the SRY protein is encoded by a single exon on the human Y chromosome Genomics 17 736 739 PMID 8244390 DOI 10 1006 geno 1993 1395 Whitfield L S Hawkins J R Goodfellow P N Sulston J 1995 41 kilobases of analyzed sequence from the pseudoautosomal and sex determining regions of the short arm of the human Y chromosome Genomics 27 306 311 PMID 7557997 DOI 10 1006 geno 1995 1047 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 King C Y Weiss M A 1993 The SRY high mobility group box recognizes DNA by partial intercalation in the minor groove a topological mechanism of sequence specificity Proc Natl Acad Sci U S A 90 11990 11994 PMID 8265659 DOI 10 1073 pnas 90 24 11990 Giese K Pagel J Grosschedl R 1994 Distinct DNA binding properties of the high mobility group domain of murine and human SRY sex determining factors Proc Natl Acad Sci U S A 91 3368 3372 PMID 8159753 DOI 10 1073 pnas 91 8 3368 Mayer A Lahr G Swaab D F Pilgrim C Reisert I 1998 The Y chromosomal genes SRY and ZFY are transcribed in adult human brain Neurogenetics 1 281 288 PMID 10732804 DOI 10 1007 s100480050042PrimitkiHuman PubMed Reference angl Arhiv originalu za 12 listopada 2017 Procitovano 12 veresnya 2017 angl Arhiv originalu za 26 zhovtnya 2017 Procitovano 12 veresnya 2017 Div takozhHromosoma YCe nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi