SNAI2 (англ. Snail family transcriptional repressor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми. Довжина поліпептидного ланцюга білка становить 268 амінокислот, а молекулярна маса — 29 986.
SNAI2 | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ідентифікатори | |||||||||||||||||
Символи | SNAI2, SLUG, SLUGH1, SNAIL2, WS2D, snail family transcriptional repressor 2, SLUGH | ||||||||||||||||
Зовнішні ІД | OMIM: 602150 MGI: 1096393 HomoloGene: 31127 GeneCards: SNAI2 | ||||||||||||||||
Пов'язані генетичні захворювання | |||||||||||||||||
Waardenburg syndrome type 2D, piebaldism | |||||||||||||||||
| |||||||||||||||||
Шаблон експресії | |||||||||||||||||
Більше даних | |||||||||||||||||
Ортологи | |||||||||||||||||
Види | Людина | Миша | |||||||||||||||
Entrez |
|
| |||||||||||||||
Ensembl |
|
| |||||||||||||||
UniProt |
|
| |||||||||||||||
RefSeq (мРНК) |
|
| |||||||||||||||
RefSeq (білок) |
|
| |||||||||||||||
Локус (UCSC) | Хр. 8: 48.92 – 48.92 Mb | Хр. 16: 14.52 – 14.53 Mb | |||||||||||||||
PubMed search | |||||||||||||||||
Вікідані | |||||||||||||||||
|
10 | 20 | 30 | 40 | 50 | ||||
---|---|---|---|---|---|---|---|---|
MPRSFLVKKH | FNASKKPNYS | ELDTHTVIIS | PYLYESYSMP | VIPQPEILSS | ||||
GAYSPITVWT | TAAPFHAQLP | NGLSPLSGYS | SSLGRVSPPP | PSDTSSKDHS | ||||
GSESPISDEE | ERLQSKLSDP | HAIEAEKFQC | NLCNKTYSTF | SGLAKHKQLH | ||||
CDAQSRKSFS | CKYCDKEYVS | LGALKMHIRT | HTLPCVCKIC | GKAFSRPWLL | ||||
QGHIRTHTGE | KPFSCPHCNR | AFADRSNLRA | HLQTHSDVKK | YQCKNCSKTF | ||||
SRMSLLHKHE | ESGCCVAH |
Кодований геном білок за функціями належить до репресорів, . Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.
Література
- Hemavathy K., Guru S.C., Harris J., Chen J.D., Ip Y.T. (2000). Human Slug is a repressor that localizes to sites of active transcription. Mol. Cell. Biol. 20: 5087—5095. PMID 10866665 DOI:10.1128/MCB.20.14.5087-5095.2000
- The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
- Mingot J.M., Vega S., Maestro B., Sanz J.M., Nieto M.A. (2009). Characterization of Snail nuclear import pathways as representatives of C2H2 zinc finger transcription factors. J. Cell Sci. 122: 1452—1460. PMID 19386897 DOI:10.1242/jcs.041749
- Hajra K.M., Chen D.Y., Fearon E.R. (2002). The SLUG zinc-finger protein represses E-cadherin in breast cancer. Cancer Res. 62: 1613—1618. PMID 11912130
Примітки
- Захворювання, генетично пов'язані з SNAI2 переглянути/редагувати посилання на ВікіДаних.
- Human PubMed Reference:.
- Mouse PubMed Reference:.
- HUGO Gene Nomenclature Commitee, HGNC:11094 (англ.) . Процитовано 7 вересня 2017.
- (англ.) . Архів оригіналу за 7 серпня 2017. Процитовано 7 вересня 2017.
Див. також
Це незавершена стаття про білки. Ви можете проєкту, виправивши або дописавши її. |
Вікіпедія, Українська, Україна, книга, книги, бібліотека, стаття, читати, завантажити, безкоштовно, безкоштовно завантажити, mp3, відео, mp4, 3gp, jpg, jpeg, gif, png, малюнок, музика, пісня, фільм, книга, гра, ігри, мобільний, телефон, android, ios, apple, мобільний телефон, samsung, iphone, xiomi, xiaomi, redmi, honor, oppo, nokia, sonya, mi, ПК, web, Інтернет
SNAI2 angl Snail family transcriptional repressor 2 bilok yakij koduyetsya odnojmennim genom roztashovanim u lyudej na korotkomu plechi 8 yi hromosomi Dovzhina polipeptidnogo lancyuga bilka stanovit 268 aminokislot a molekulyarna masa 29 986 SNAI2IdentifikatoriSimvoliSNAI2 SLUG SLUGH1 SNAIL2 WS2D snail family transcriptional repressor 2 SLUGHZovnishni ID OMIM 602150 MGI 1096393 HomoloGene 31127 GeneCards SNAI2Pov yazani genetichni zahvoryuvannyaWaardenburg syndrome type 2D piebaldism Ontologiya genaMolekulyarna funkciya sequence specific DNA binding DNA binding zv yazuvannya z ionom metalu GO 0001948 GO 0016582 protein binding nucleic acid binding GO 0001200 GO 0001133 GO 0001201 DNA binding transcription factor activity RNA polymerase II specific GO 0001078 GO 0001214 GO 0001206 DNA binding transcription repressor activity RNA polymerase II specific RNA polymerase II transcription regulatory region sequence specific DNA binding chromatin binding GO 0001131 GO 0001151 GO 0001130 GO 0001204 DNA binding transcription factor activity transcription factor activity RNA polymerase II distal enhancer sequence specific binding E box bindingKlitinna komponenta citoplazma klitinne yadro nukleoplazmaBiologichnij proces Signalnij shlyah Notch negative regulation of vitamin D receptor signaling pathway GO 0009373 regulation of transcription DNA templated neural crest cell development negative regulation of keratinocyte proliferation regulation of bicellular tight junction assembly positive regulation of cell migration negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage transcription DNA templated cellular response to epidermal growth factor stimulus negative regulation of vitamin D biosynthetic process regulation of chemokine production multicellular organism development negative regulation of chondrocyte differentiation negative regulation of DNA damage response signal transduction by p53 class mediator regulation of osteoblast differentiation osteoblast differentiation canonical Wnt signaling pathway negative regulation of canonical Wnt signaling pathway negative regulation of cell adhesion mediated by integrin negative regulation of anoikis GO 1901227 negative regulation of transcription by RNA polymerase II Epitelialno mezenhimalnij perehid epithelial to mesenchymal transition involved in endocardial cushion formation cell migration involved in endocardial cushion formation sluh desmosome disassembly pigmentation epithelium development negative regulation of extrinsic apoptotic signaling pathway in absence of ligand aortic valve morphogenesis negative regulation of cell adhesion involved in substrate bound cell migration response to radiation cell migration positive regulation of histone acetylation negative regulation of apoptotic process positive regulation of fat cell differentiation white fat cell differentiation roof of mouth development cartilage morphogenesis regulation of branching involved in salivary gland morphogenesis cellular response to ionizing radiation negative regulation of stem cell proliferation Notch signaling involved in heart developmentDzherela Amigo QuickGOShablon ekspresiyiBilshe danihOrtologiVidi Lyudina MishaEntrez6591 20583Ensembl ENSG00000019549 ENSMUSG00000022676UniProt O43623 P97469RefSeq mRNK NM 003068NM 011415RefSeq bilok NP 003059NP 035545Lokus UCSC Hr 8 48 92 48 92 MbHr 16 14 52 14 53 MbPubMed searchVikidaniDiv Red dlya lyudejDiv Red dlya mishej Poslidovnist aminokislot1020304050 MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSS GAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHS GSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLH CDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLL QGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTF SRMSLLHKHEESGCCVAH A Alanin C Cisteyin D Asparaginova kislota E Glutaminova kislota F Fenilalanin G Glicin H Gistidin I Izolejcin K Lizin L Lejcin M Metionin N Asparagin P Prolin Q Glutamin R Arginin S Serin T Treonin V Valin W Triptofan Y Tirozin Kodovanij genom bilok za funkciyami nalezhit do represoriv Zadiyanij u takih biologichnih procesah yak transkripciya regulyaciya transkripciyi Bilok maye sajt dlya zv yazuvannya z ionami metaliv ionom cinku DNK Lokalizovanij u citoplazmi yadri LiteraturaHemavathy K Guru S C Harris J Chen J D Ip Y T 2000 Human Slug is a repressor that localizes to sites of active transcription Mol Cell Biol 20 5087 5095 PMID 10866665 DOI 10 1128 MCB 20 14 5087 5095 2000 The status quality and expansion of the NIH full length cDNA project the Mammalian Gene Collection MGC Genome Res 14 2121 2127 2004 PMID 15489334 DOI 10 1101 gr 2596504 Mingot J M Vega S Maestro B Sanz J M Nieto M A 2009 Characterization of Snail nuclear import pathways as representatives of C2H2 zinc finger transcription factors J Cell Sci 122 1452 1460 PMID 19386897 DOI 10 1242 jcs 041749 Hajra K M Chen D Y Fearon E R 2002 The SLUG zinc finger protein represses E cadherin in breast cancer Cancer Res 62 1613 1618 PMID 11912130PrimitkiZahvoryuvannya genetichno pov yazani z SNAI2 pereglyanuti redaguvati posilannya na VikiDanih Human PubMed Reference Mouse PubMed Reference HUGO Gene Nomenclature Commitee HGNC 11094 angl Procitovano 7 veresnya 2017 angl Arhiv originalu za 7 serpnya 2017 Procitovano 7 veresnya 2017 Div takozhHromosoma 8 Ce nezavershena stattya pro bilki Vi mozhete dopomogti proyektu vipravivshi abo dopisavshi yiyi